BLASTX nr result
ID: Cheilocostus21_contig00045496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00045496 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020689233.1| uncharacterized protein LOC110104462 [Dendro... 57 2e-06 >ref|XP_020689233.1| uncharacterized protein LOC110104462 [Dendrobium catenatum] Length = 211 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +1 Query: 319 SILFWNHSLVGYFIGLRPAYRALKEKAQELWKVQYDVEMSSLSGEFILFRFGSEKDKFKA 498 +++ WN LVGY +G RP Y ALKE A +WK++ E+ +L+ F LF+F KD Sbjct: 18 AVVEWNLCLVGYSVGKRPYYEALKETAMRIWKLKGTFELIALTDGFFLFKFSLPKDYDMV 77 Query: 499 LESGSLSF 522 G+ F Sbjct: 78 WSKGAWFF 85