BLASTX nr result
ID: Cheilocostus21_contig00045462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00045462 (1374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390670.1| PREDICTED: heterogeneous nuclear ribonucleop... 64 3e-07 ref|XP_009390662.1| PREDICTED: heterogeneous nuclear ribonucleop... 64 3e-07 >ref|XP_009390670.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 719 Score = 64.3 bits (155), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 1284 MKVRARLANPLPKTQAVKGGMSGGYRIGYT 1373 MKVRARLANPLPKTQAVKGGMSGGYRIGYT Sbjct: 494 MKVRARLANPLPKTQAVKGGMSGGYRIGYT 523 >ref|XP_009390662.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 723 Score = 64.3 bits (155), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 1284 MKVRARLANPLPKTQAVKGGMSGGYRIGYT 1373 MKVRARLANPLPKTQAVKGGMSGGYRIGYT Sbjct: 494 MKVRARLANPLPKTQAVKGGMSGGYRIGYT 523