BLASTX nr result
ID: Cheilocostus21_contig00045066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00045066 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018673492.1| PREDICTED: transcription initiation factor T... 60 2e-07 ref|XP_018685033.1| PREDICTED: transcription initiation factor T... 60 2e-07 ref|XP_009411258.1| PREDICTED: transcription initiation factor T... 60 2e-07 ref|XP_022889776.1| transcription initiation factor TFIID subuni... 54 2e-06 gb|PKA64200.1| Dynein assembly factor with WDR repeat domains 1 ... 57 2e-06 gb|PIN00739.1| hypothetical protein CDL12_26758 [Handroanthus im... 55 3e-06 ref|XP_020677718.1| transcription initiation factor TFIID subuni... 55 8e-06 ref|XP_020677713.1| transcription initiation factor TFIID subuni... 55 8e-06 >ref|XP_018673492.1| PREDICTED: transcription initiation factor TFIID subunit 5-like [Musa acuminata subsp. malaccensis] Length = 579 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGALQKC 363 LLKA PT+STPVY LQFSRRNLLFAAGAL KC Sbjct: 547 LLKALPTKSTPVYTLQFSRRNLLFAAGALSKC 578 >ref|XP_018685033.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform X2 [Musa acuminata subsp. malaccensis] Length = 657 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGALQKC 363 LLKA PT+STPVY LQFSRRNLLFAAGAL KC Sbjct: 626 LLKALPTKSTPVYTLQFSRRNLLFAAGALSKC 657 >ref|XP_009411258.1| PREDICTED: transcription initiation factor TFIID subunit 5 isoform X1 [Musa acuminata subsp. malaccensis] Length = 658 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGALQKC 363 LLKA PT+STPVY LQFSRRNLLFAAGAL KC Sbjct: 627 LLKALPTKSTPVYTLQFSRRNLLFAAGALSKC 658 >ref|XP_022889776.1| transcription initiation factor TFIID subunit 5-like [Olea europaea var. sylvestris] Length = 124 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 455 LKAFPTRSTPVYALQFSRRNLLFAAGALQK 366 LK PT+STPVYALQFSRRNLLFAAGAL K Sbjct: 93 LKTLPTKSTPVYALQFSRRNLLFAAGALTK 122 >gb|PKA64200.1| Dynein assembly factor with WDR repeat domains 1 [Apostasia shenzhenica] Length = 653 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGALQK 366 LLKA PT+STPVY+LQFSRRNLLFAAGAL K Sbjct: 622 LLKALPTKSTPVYSLQFSRRNLLFAAGALSK 652 >gb|PIN00739.1| hypothetical protein CDL12_26758 [Handroanthus impetiginosus] Length = 176 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 455 LKAFPTRSTPVYALQFSRRNLLFAAGALQK 366 LK PT+STPVYALQFSRRNLLFAAGAL K Sbjct: 145 LKTLPTKSTPVYALQFSRRNLLFAAGALSK 174 >ref|XP_020677718.1| transcription initiation factor TFIID subunit 5 isoform X2 [Dendrobium catenatum] Length = 656 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGA 375 LLKAFPT+STPVY LQFSRRNLLFAAGA Sbjct: 624 LLKAFPTKSTPVYTLQFSRRNLLFAAGA 651 >ref|XP_020677713.1| transcription initiation factor TFIID subunit 5 isoform X1 [Dendrobium catenatum] ref|XP_020677714.1| transcription initiation factor TFIID subunit 5 isoform X1 [Dendrobium catenatum] ref|XP_020677715.1| transcription initiation factor TFIID subunit 5 isoform X1 [Dendrobium catenatum] ref|XP_020677716.1| transcription initiation factor TFIID subunit 5 isoform X1 [Dendrobium catenatum] ref|XP_020677717.1| transcription initiation factor TFIID subunit 5 isoform X1 [Dendrobium catenatum] Length = 657 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 458 LLKAFPTRSTPVYALQFSRRNLLFAAGA 375 LLKAFPT+STPVY LQFSRRNLLFAAGA Sbjct: 625 LLKAFPTKSTPVYTLQFSRRNLLFAAGA 652