BLASTX nr result
ID: Cheilocostus21_contig00044823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044823 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008782001.1| PREDICTED: F-box protein At3g54460 [Phoenix ... 68 4e-10 ref|XP_009382584.1| PREDICTED: F-box protein At3g54460 isoform X... 67 5e-10 ref|XP_009382583.1| PREDICTED: F-box protein At3g54460 isoform X... 67 5e-10 gb|KDO49062.1| hypothetical protein CISIN_1g0010982mg, partial [... 60 5e-09 gb|PIA48159.1| hypothetical protein AQUCO_01400621v1 [Aquilegia ... 64 8e-09 gb|PIA48161.1| hypothetical protein AQUCO_01400621v1 [Aquilegia ... 64 8e-09 ref|XP_010276587.1| PREDICTED: F-box protein At3g54460-like [Nel... 60 1e-07 ref|XP_024036235.1| F-box protein At3g54460 isoform X2 [Citrus c... 60 2e-07 ref|XP_006470853.1| PREDICTED: F-box protein At3g54460 isoform X... 60 2e-07 ref|XP_024036220.1| F-box protein At3g54460 isoform X1 [Citrus c... 60 2e-07 dbj|GAY48627.1| hypothetical protein CUMW_113140 [Citrus unshiu] 60 2e-07 ref|XP_008245694.1| PREDICTED: F-box protein At3g54460-like [Pru... 57 2e-07 ref|XP_022867167.1| F-box protein At3g54460 isoform X1 [Olea eur... 60 2e-07 ref|XP_011020388.1| PREDICTED: F-box protein At3g54460 [Populus ... 59 5e-07 ref|XP_022139012.1| F-box protein At3g54460 [Momordica charantia] 59 5e-07 ref|XP_010938574.1| PREDICTED: F-box protein At3g54460 [Elaeis g... 59 5e-07 ref|XP_008348293.1| PREDICTED: F-box protein At3g54460 isoform X... 59 6e-07 ref|XP_023526902.1| F-box protein At3g54460-like isoform X3 [Cuc... 59 6e-07 ref|XP_022956679.1| F-box protein At3g54460 isoform X1 [Cucurbit... 59 6e-07 gb|PON60049.1| F-box protein [Parasponia andersonii] 58 1e-06 >ref|XP_008782001.1| PREDICTED: F-box protein At3g54460 [Phoenix dactylifera] ref|XP_008782002.1| PREDICTED: F-box protein At3g54460 [Phoenix dactylifera] Length = 1382 Score = 67.8 bits (164), Expect = 4e-10 Identities = 29/42 (69%), Positives = 39/42 (92%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 RTLK+E+ K ++EG+R HRT+HDFAESNYLA+L+FVRTN++A Sbjct: 1341 RTLKEESRKTDHEGSRGHRTIHDFAESNYLAELSFVRTNVKA 1382 >ref|XP_009382584.1| PREDICTED: F-box protein At3g54460 isoform X2 [Musa acuminata subsp. malaccensis] Length = 1159 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 475 TLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 T KQE +K+EYEGTR HRTLH+FAESNYLA+L+FV TN++A Sbjct: 1119 TFKQEVDKDEYEGTRAHRTLHNFAESNYLARLSFVCTNVKA 1159 >ref|XP_009382583.1| PREDICTED: F-box protein At3g54460 isoform X1 [Musa acuminata subsp. malaccensis] Length = 1372 Score = 67.4 bits (163), Expect = 5e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 475 TLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 T KQE +K+EYEGTR HRTLH+FAESNYLA+L+FV TN++A Sbjct: 1332 TFKQEVDKDEYEGTRAHRTLHNFAESNYLARLSFVCTNVKA 1372 >gb|KDO49062.1| hypothetical protein CISIN_1g0010982mg, partial [Citrus sinensis] gb|KDO49063.1| hypothetical protein CISIN_1g0010982mg, partial [Citrus sinensis] Length = 84 Score = 60.1 bits (144), Expect = 5e-09 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K E EG R+HRTLHDFAESNYL+ L+FVRTN Sbjct: 45 RLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTN 83 >gb|PIA48159.1| hypothetical protein AQUCO_01400621v1 [Aquilegia coerulea] gb|PIA48160.1| hypothetical protein AQUCO_01400621v1 [Aquilegia coerulea] Length = 1329 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 +TLK+E + ++EGTR HRTLHDFAE NYLAQL+FVRTN A Sbjct: 1287 QTLKEEFGRTDHEGTRPHRTLHDFAERNYLAQLSFVRTNSNA 1328 >gb|PIA48161.1| hypothetical protein AQUCO_01400621v1 [Aquilegia coerulea] Length = 1349 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 +TLK+E + ++EGTR HRTLHDFAE NYLAQL+FVRTN A Sbjct: 1307 QTLKEEFGRTDHEGTRPHRTLHDFAERNYLAQLSFVRTNSNA 1348 >ref|XP_010276587.1| PREDICTED: F-box protein At3g54460-like [Nelumbo nucifera] Length = 1375 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 RT+K+E + + G R HRTLHDFAESNYLAQL+FVRTN Sbjct: 1334 RTMKEELGRTDCGGARVHRTLHDFAESNYLAQLSFVRTN 1372 >ref|XP_024036235.1| F-box protein At3g54460 isoform X2 [Citrus clementina] Length = 1326 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K E EG R+HRTLHDFAESNYL+ L+FVRTN Sbjct: 1287 RLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTN 1325 >ref|XP_006470853.1| PREDICTED: F-box protein At3g54460 isoform X1 [Citrus sinensis] ref|XP_006470857.1| PREDICTED: F-box protein At3g54460 isoform X1 [Citrus sinensis] Length = 1339 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K E EG R+HRTLHDFAESNYL+ L+FVRTN Sbjct: 1300 RLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTN 1338 >ref|XP_024036220.1| F-box protein At3g54460 isoform X1 [Citrus clementina] ref|XP_024036225.1| F-box protein At3g54460 isoform X1 [Citrus clementina] ref|XP_024036230.1| F-box protein At3g54460 isoform X1 [Citrus clementina] gb|ESR33967.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] gb|ESR33968.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] gb|ESR33969.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] gb|ESR33970.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] gb|ESR33971.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] gb|ESR33972.1| hypothetical protein CICLE_v10004162mg [Citrus clementina] Length = 1339 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K E EG R+HRTLHDFAESNYL+ L+FVRTN Sbjct: 1300 RLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTN 1338 >dbj|GAY48627.1| hypothetical protein CUMW_113140 [Citrus unshiu] Length = 1395 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K E EG R+HRTLHDFAESNYL+ L+FVRTN Sbjct: 1300 RLLKEELVKPEREGARSHRTLHDFAESNYLSHLSFVRTN 1338 >ref|XP_008245694.1| PREDICTED: F-box protein At3g54460-like [Prunus mume] ref|XP_016652666.1| PREDICTED: F-box protein At3g54460-like [Prunus mume] Length = 112 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E K + +G RT R+LHDFAESNYL+Q++FVRTN Sbjct: 72 RFLKEEVGKSDPKGARTRRSLHDFAESNYLSQISFVRTN 110 >ref|XP_022867167.1| F-box protein At3g54460 isoform X1 [Olea europaea var. sylvestris] ref|XP_022867168.1| F-box protein At3g54460 isoform X2 [Olea europaea var. sylvestris] Length = 1361 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLR 356 R LK+E + +GTR++RTLHDFAESNYLA L+FVRTN R Sbjct: 1312 RLLKEEFGTNDLDGTRSYRTLHDFAESNYLAHLSFVRTNFR 1352 >ref|XP_011020388.1| PREDICTED: F-box protein At3g54460 [Populus euphratica] Length = 1342 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLR 356 R LK+E++K ++EG R HR+LHDFAESNYLA L+FV T R Sbjct: 1301 RVLKEESSKTDHEGARLHRSLHDFAESNYLAHLSFVHTGSR 1341 >ref|XP_022139012.1| F-box protein At3g54460 [Momordica charantia] Length = 1370 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLR 356 R LK+E K +YEG R HR+LHDFA SNYL+QL FVRTN + Sbjct: 1323 RLLKEEFIKPDYEGPRAHRSLHDFAGSNYLSQLKFVRTNAK 1363 >ref|XP_010938574.1| PREDICTED: F-box protein At3g54460 [Elaeis guineensis] Length = 1381 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLRA 353 R + E++K ++ G+R HRTLHDFAESNYLA+L+FVRTN++A Sbjct: 1340 RMPRAESSKTDHGGSRGHRTLHDFAESNYLAELSFVRTNVKA 1381 >ref|XP_008348293.1| PREDICTED: F-box protein At3g54460 isoform X1 [Malus domestica] Length = 1333 Score = 58.5 bits (140), Expect = 6e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTNLR 356 R LK+EA K E G RT R+LHDFAESNYL+ L+FVRTN R Sbjct: 1292 RFLKEEAGKSEPTGARTQRSLHDFAESNYLSHLSFVRTNSR 1332 >ref|XP_023526902.1| F-box protein At3g54460-like isoform X3 [Cucurbita pepo subsp. pepo] Length = 1368 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R +K+E +K +YEG R HR++HDFA SNYL+QL FVRTN Sbjct: 1320 RLMKEEFSKPDYEGPRAHRSMHDFAGSNYLSQLKFVRTN 1358 >ref|XP_022956679.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] ref|XP_022956680.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] ref|XP_022956681.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] ref|XP_022956682.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] ref|XP_022956683.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] ref|XP_022956684.1| F-box protein At3g54460 isoform X1 [Cucurbita moschata] Length = 1369 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R +K+E +K +YEG R HR++HDFA SNYL+QL FVRTN Sbjct: 1321 RLMKEEFSKPDYEGPRAHRSMHDFAGSNYLSQLKFVRTN 1359 >gb|PON60049.1| F-box protein [Parasponia andersonii] Length = 1356 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 478 RTLKQEANKEEYEGTRTHRTLHDFAESNYLAQLNFVRTN 362 R LK+E + EG RTHR+LHDFAE+NYL+QL FVRTN Sbjct: 1315 RFLKKEFGSSDCEGARTHRSLHDFAENNYLSQLRFVRTN 1353