BLASTX nr result
ID: Cheilocostus21_contig00044800
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044800 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009396283.1| PREDICTED: pentatricopeptide repeat-containi... 136 6e-34 ref|XP_017702002.1| PREDICTED: pentatricopeptide repeat-containi... 132 2e-32 ref|XP_019701364.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-30 ref|XP_010942600.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-30 gb|PKA58660.1| Pentatricopeptide repeat-containing protein [Apos... 108 2e-24 gb|ERN19236.1| hypothetical protein AMTR_s00061p00202160 [Ambore... 108 2e-24 ref|XP_020531217.1| pentatricopeptide repeat-containing protein ... 108 2e-24 ref|XP_020599014.1| pentatricopeptide repeat-containing protein ... 106 1e-23 ref|XP_020599013.1| pentatricopeptide repeat-containing protein ... 106 1e-23 ref|XP_020599012.1| pentatricopeptide repeat-containing protein ... 106 1e-23 ref|XP_020599010.1| pentatricopeptide repeat-containing protein ... 106 1e-23 gb|ERN05606.1| hypothetical protein AMTR_s00006p00023030 [Ambore... 102 1e-22 ref|XP_020675478.1| pentatricopeptide repeat-containing protein ... 103 2e-22 ref|XP_020675476.1| pentatricopeptide repeat-containing protein ... 103 2e-22 ref|XP_020675474.1| pentatricopeptide repeat-containing protein ... 103 2e-22 ref|XP_020522800.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 102 4e-22 ref|XP_015632904.1| PREDICTED: pentatricopeptide repeat-containi... 100 9e-22 ref|XP_020099959.1| pentatricopeptide repeat-containing protein ... 101 1e-21 gb|AAT78758.1| putative pentatricopeptide repeat-containing prot... 100 2e-21 gb|EEC75711.1| hypothetical protein OsI_12542 [Oryza sativa Indi... 100 2e-21 >ref|XP_009396283.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Musa acuminata subsp. malaccensis] ref|XP_009396284.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Musa acuminata subsp. malaccensis] ref|XP_009396285.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Musa acuminata subsp. malaccensis] ref|XP_018681040.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Musa acuminata subsp. malaccensis] ref|XP_018681041.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Musa acuminata subsp. malaccensis] Length = 1068 Score = 136 bits (342), Expect = 6e-34 Identities = 64/95 (67%), Positives = 78/95 (82%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLI+G C++G AWRLYEE+KQK LWPN+TTYT+LI AV+KE I E +ILLKDIE Sbjct: 972 YNVLISGFCSIGCLSDAWRLYEEIKQKGLWPNITTYTMLIDAVHKEHKIFEADILLKDIE 1031 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGV 210 RGLISSQ NSKT+ E L NA+RRL++LRHCR+ + Sbjct: 1032 TRGLISSQGNSKTICEGLANAVRRLNELRHCRRTI 1066 >ref|XP_017702002.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Phoenix dactylifera] ref|XP_017702003.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Phoenix dactylifera] ref|XP_017702004.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Phoenix dactylifera] ref|XP_017702005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Phoenix dactylifera] Length = 847 Score = 132 bits (331), Expect = 2e-32 Identities = 64/96 (66%), Positives = 73/96 (76%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC G+ AW+LY EMK K LWPN+TTYTVLI +VYKE ++EG LLKDI Sbjct: 749 YNVLITGLCTNGHLADAWKLYMEMKDKGLWPNITTYTVLIDSVYKENKLTEGETLLKDIL 808 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVN 207 RGLISSQ N L E L NAMRRL++LRHCRK +N Sbjct: 809 DRGLISSQKNISNLHEGLANAMRRLNNLRHCRKRIN 844 >ref|XP_019701364.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Elaeis guineensis] Length = 958 Score = 125 bits (315), Expect = 2e-30 Identities = 62/98 (63%), Positives = 72/98 (73%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC AW+LY EMK K LWPN+TTYTVLI +VYKE ++EG LLKD+ Sbjct: 860 YNVLITGLCANDRLADAWKLYMEMKDKGLWPNITTYTVLIDSVYKENKLTEGETLLKDML 919 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNLK 201 RGLISSQ N L + L NAMRRL++LRHCRK +N K Sbjct: 920 DRGLISSQNNISNLHQGLANAMRRLNNLRHCRKRINTK 957 >ref|XP_010942600.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] ref|XP_019701358.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] ref|XP_019701359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] ref|XP_019701360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] ref|XP_019701362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] ref|XP_019701363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Elaeis guineensis] Length = 1135 Score = 125 bits (315), Expect = 2e-30 Identities = 62/98 (63%), Positives = 72/98 (73%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC AW+LY EMK K LWPN+TTYTVLI +VYKE ++EG LLKD+ Sbjct: 1037 YNVLITGLCANDRLADAWKLYMEMKDKGLWPNITTYTVLIDSVYKENKLTEGETLLKDML 1096 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNLK 201 RGLISSQ N L + L NAMRRL++LRHCRK +N K Sbjct: 1097 DRGLISSQNNISNLHQGLANAMRRLNNLRHCRKRINTK 1134 >gb|PKA58660.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 466 Score = 108 bits (269), Expect = 2e-24 Identities = 54/93 (58%), Positives = 65/93 (69%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC+ G+ A +LYEEM+QK LWPN+TTYTVLI A+ KE + EG LL DI Sbjct: 374 YNVLITGLCSHGHLDKALKLYEEMQQKFLWPNITTYTVLIDAIKKENKVIEGEKLLDDIH 433 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS + N + + L N RRL+ LRHC K Sbjct: 434 RRGLISLRENVSGIDDELTNTKRRLNMLRHCCK 466 >gb|ERN19236.1| hypothetical protein AMTR_s00061p00202160 [Amborella trichopoda] Length = 1061 Score = 108 bits (271), Expect = 2e-24 Identities = 55/93 (59%), Positives = 68/93 (73%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNV+ITGLCN G VA+ LYEEMK+K LWPN+TTYTVLI A+ K S+G +LL DI Sbjct: 962 YNVVITGLCNNGCIAVAFELYEEMKRKGLWPNITTYTVLIEALLKGIDQSKGELLLMDIR 1021 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS + + + ERLV A+RRL+ LR C+K Sbjct: 1022 ERGLISHENMNLGVHERLVRALRRLNGLRRCKK 1054 >ref|XP_020531217.1| pentatricopeptide repeat-containing protein At5g55840 [Amborella trichopoda] ref|XP_020531218.1| pentatricopeptide repeat-containing protein At5g55840 [Amborella trichopoda] ref|XP_020531219.1| pentatricopeptide repeat-containing protein At5g55840 [Amborella trichopoda] ref|XP_020531220.1| pentatricopeptide repeat-containing protein At5g55840 [Amborella trichopoda] Length = 1158 Score = 108 bits (271), Expect = 2e-24 Identities = 55/93 (59%), Positives = 68/93 (73%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNV+ITGLCN G VA+ LYEEMK+K LWPN+TTYTVLI A+ K S+G +LL DI Sbjct: 1059 YNVVITGLCNNGCIAVAFELYEEMKRKGLWPNITTYTVLIEALLKGIDQSKGELLLMDIR 1118 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS + + + ERLV A+RRL+ LR C+K Sbjct: 1119 ERGLISHENMNLGVHERLVRALRRLNGLRRCKK 1151 >ref|XP_020599014.1| pentatricopeptide repeat-containing protein At5g55840 isoform X4 [Phalaenopsis equestris] ref|XP_020599015.1| pentatricopeptide repeat-containing protein At5g55840 isoform X4 [Phalaenopsis equestris] Length = 1059 Score = 106 bits (265), Expect = 1e-23 Identities = 55/93 (59%), Positives = 67/93 (72%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC G F A +LYEEMKQK LWPNVTTYTVLI AV + + + EG +LKDI+ Sbjct: 963 YNVLITGLCVRGLFDGALKLYEEMKQKGLWPNVTTYTVLIDAVKRVKDLIEGEKILKDIQ 1022 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLI+ + +L + L +A RRL+ LRHC K Sbjct: 1023 DRGLIADKKRIASLDDELRSAKRRLNMLRHCWK 1055 >ref|XP_020599013.1| pentatricopeptide repeat-containing protein At5g55840 isoform X3 [Phalaenopsis equestris] Length = 1127 Score = 106 bits (265), Expect = 1e-23 Identities = 55/93 (59%), Positives = 67/93 (72%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC G F A +LYEEMKQK LWPNVTTYTVLI AV + + + EG +LKDI+ Sbjct: 1031 YNVLITGLCVRGLFDGALKLYEEMKQKGLWPNVTTYTVLIDAVKRVKDLIEGEKILKDIQ 1090 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLI+ + +L + L +A RRL+ LRHC K Sbjct: 1091 DRGLIADKKRIASLDDELRSAKRRLNMLRHCWK 1123 >ref|XP_020599012.1| pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Phalaenopsis equestris] Length = 1182 Score = 106 bits (265), Expect = 1e-23 Identities = 55/93 (59%), Positives = 67/93 (72%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC G F A +LYEEMKQK LWPNVTTYTVLI AV + + + EG +LKDI+ Sbjct: 1086 YNVLITGLCVRGLFDGALKLYEEMKQKGLWPNVTTYTVLIDAVKRVKDLIEGEKILKDIQ 1145 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLI+ + +L + L +A RRL+ LRHC K Sbjct: 1146 DRGLIADKKRIASLDDELRSAKRRLNMLRHCWK 1178 >ref|XP_020599010.1| pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Phalaenopsis equestris] ref|XP_020599011.1| pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Phalaenopsis equestris] Length = 1183 Score = 106 bits (265), Expect = 1e-23 Identities = 55/93 (59%), Positives = 67/93 (72%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC G F A +LYEEMKQK LWPNVTTYTVLI AV + + + EG +LKDI+ Sbjct: 1087 YNVLITGLCVRGLFDGALKLYEEMKQKGLWPNVTTYTVLIDAVKRVKDLIEGEKILKDIQ 1146 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLI+ + +L + L +A RRL+ LRHC K Sbjct: 1147 DRGLIADKKRIASLDDELRSAKRRLNMLRHCWK 1179 >gb|ERN05606.1| hypothetical protein AMTR_s00006p00023030 [Amborella trichopoda] Length = 391 Score = 102 bits (254), Expect = 1e-22 Identities = 51/93 (54%), Positives = 66/93 (70%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNV+ITGLCN G VA+ YE+MK++ LWPN+T YTVLI A+ KE S+G +LL DI Sbjct: 292 YNVVITGLCNNGRIAVAFEFYEDMKRERLWPNITMYTVLIEALLKEIDQSKGELLLMDIR 351 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS + + + ERL A+RRL+ LR C+K Sbjct: 352 ERGLISYENINLGVHERLYRALRRLNGLRRCKK 384 >ref|XP_020675478.1| pentatricopeptide repeat-containing protein At5g55840 isoform X3 [Dendrobium catenatum] Length = 1093 Score = 103 bits (256), Expect = 2e-22 Identities = 53/93 (56%), Positives = 66/93 (70%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVL+TGLC G+ A LYEE+K+K+LWPNVTTYTVLI A+ +E + EG LLKDI+ Sbjct: 989 YNVLMTGLCAHGHVDDALNLYEEIKRKSLWPNVTTYTVLIDAITRENKLIEGEKLLKDIQ 1048 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS Q +L + L + RRL+ LRHC K Sbjct: 1049 DRGLISHQKAISSLHDELRSTKRRLNMLRHCWK 1081 >ref|XP_020675476.1| pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Dendrobium catenatum] ref|XP_020675477.1| pentatricopeptide repeat-containing protein At5g55840 isoform X2 [Dendrobium catenatum] gb|PKU71019.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 1141 Score = 103 bits (256), Expect = 2e-22 Identities = 53/93 (56%), Positives = 66/93 (70%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVL+TGLC G+ A LYEE+K+K+LWPNVTTYTVLI A+ +E + EG LLKDI+ Sbjct: 1037 YNVLMTGLCAHGHVDDALNLYEEIKRKSLWPNVTTYTVLIDAITRENKLIEGEKLLKDIQ 1096 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS Q +L + L + RRL+ LRHC K Sbjct: 1097 DRGLISHQKAISSLHDELRSTKRRLNMLRHCWK 1129 >ref|XP_020675474.1| pentatricopeptide repeat-containing protein At5g55840 isoform X1 [Dendrobium catenatum] Length = 1190 Score = 103 bits (256), Expect = 2e-22 Identities = 53/93 (56%), Positives = 66/93 (70%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVL+TGLC G+ A LYEE+K+K+LWPNVTTYTVLI A+ +E + EG LLKDI+ Sbjct: 1086 YNVLMTGLCAHGHVDDALNLYEEIKRKSLWPNVTTYTVLIDAITRENKLIEGEKLLKDIQ 1145 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS Q +L + L + RRL+ LRHC K Sbjct: 1146 DRGLISHQKAISSLHDELRSTKRRLNMLRHCWK 1178 >ref|XP_020522800.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g55840 [Amborella trichopoda] Length = 932 Score = 102 bits (254), Expect = 4e-22 Identities = 51/93 (54%), Positives = 66/93 (70%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNV+ITGLCN G VA+ YE+MK++ LWPN+T YTVLI A+ KE S+G +LL DI Sbjct: 833 YNVVITGLCNNGRIAVAFEFYEDMKRERLWPNITMYTVLIEALLKEIDQSKGELLLMDIR 892 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRK 216 RGLIS + + + ERL A+RRL+ LR C+K Sbjct: 893 ERGLISYENINLGVHERLYRALRRLNGLRRCKK 925 >ref|XP_015632904.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like isoform X3 [Oryza sativa Japonica Group] Length = 438 Score = 100 bits (249), Expect = 9e-22 Identities = 50/98 (51%), Positives = 67/98 (68%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLCN A LYEEMK K L PN+TTY L A+Y T+ +G LLKDIE Sbjct: 327 YNVLITGLCNKKCICDALDLYEEMKSKGLLPNITTYITLTGAMYATGTMQDGEKLLKDIE 386 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNLK 201 RG++ S + ++L R+ NA++RL+ +R+CRKG++ K Sbjct: 387 DRGIVPSYKHPESLEWRMENAIKRLNTIRNCRKGISFK 424 >ref|XP_020099959.1| pentatricopeptide repeat-containing protein At5g55840 [Ananas comosus] Length = 1014 Score = 101 bits (251), Expect = 1e-21 Identities = 48/97 (49%), Positives = 69/97 (71%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLC A +LYEE+ Q+ LWPN+TTYTVLI A Y+E + EG LL+DI+ Sbjct: 916 YNVLITGLCETSRVSDALKLYEEIIQRELWPNITTYTVLIEAFYRENRVEEGEKLLQDIQ 975 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNL 204 RGL+SS+ + + L +AM+RL+ +R+CR+ +++ Sbjct: 976 NRGLMSSENVPTSFHQGLESAMKRLNSIRNCRRRISV 1012 >gb|AAT78758.1| putative pentatricopeptide repeat-containing protein [Oryza sativa Japonica Group] gb|ABF97511.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] Length = 1025 Score = 100 bits (249), Expect = 2e-21 Identities = 50/98 (51%), Positives = 67/98 (68%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLCN A LYEEMK K L PN+TTY L A+Y T+ +G LLKDIE Sbjct: 914 YNVLITGLCNKKCICDALDLYEEMKSKGLLPNITTYITLTGAMYATGTMQDGEKLLKDIE 973 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNLK 201 RG++ S + ++L R+ NA++RL+ +R+CRKG++ K Sbjct: 974 DRGIVPSYKHPESLEWRMENAIKRLNTIRNCRKGISFK 1011 >gb|EEC75711.1| hypothetical protein OsI_12542 [Oryza sativa Indica Group] Length = 1031 Score = 100 bits (249), Expect = 2e-21 Identities = 50/98 (51%), Positives = 67/98 (68%) Frame = -3 Query: 494 YNVLITGLCNLGYFPVAWRLYEEMKQKNLWPNVTTYTVLISAVYKEQTISEGNILLKDIE 315 YNVLITGLCN A LYEEMK K L PN+TTY L A+Y T+ +G LLKDIE Sbjct: 920 YNVLITGLCNKKCICDALDLYEEMKSKGLLPNITTYITLTGAMYATGTMQDGEKLLKDIE 979 Query: 314 ARGLISSQANSKTLPERLVNAMRRLDDLRHCRKGVNLK 201 RG++ S + ++L R+ NA++RL+ +R+CRKG++ K Sbjct: 980 DRGIVPSYKHPESLEWRMENAIKRLNTIRNCRKGISFK 1017