BLASTX nr result
ID: Cheilocostus21_contig00044631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044631 (865 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008782167.1| PREDICTED: 40S ribosomal protein S6-like iso... 64 2e-08 ref|XP_021816386.1| 40S ribosomal protein S6 [Prunus avium] 65 2e-08 ref|XP_007205780.1| 40S ribosomal protein S6 [Prunus persica] >g... 65 2e-08 gb|OVA15684.1| Ribosomal protein S6e [Macleaya cordata] 64 3e-08 gb|OUZ99608.1| Ribosomal protein S6e [Macleaya cordata] 64 3e-08 ref|XP_020695778.1| 40S ribosomal protein S6 [Dendrobium catenat... 64 3e-08 ref|XP_020090000.1| 40S ribosomal protein S6-like isoform X2 [An... 64 3e-08 ref|XP_010937382.1| PREDICTED: 40S ribosomal protein S6 [Elaeis ... 64 3e-08 ref|XP_010273001.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo... 64 3e-08 ref|XP_009380211.1| PREDICTED: 40S ribosomal protein S6 [Musa ac... 64 3e-08 ref|XP_009390279.1| PREDICTED: 40S ribosomal protein S6 [Musa ac... 64 3e-08 ref|XP_008804777.1| PREDICTED: 40S ribosomal protein S6 [Phoenix... 64 3e-08 ref|XP_008790913.1| PREDICTED: 40S ribosomal protein S6 [Phoenix... 64 3e-08 ref|XP_008782166.1| PREDICTED: 40S ribosomal protein S6-like iso... 64 3e-08 ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 [Vitis v... 64 3e-08 ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis v... 64 3e-08 ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform ... 64 3e-08 gb|OVA02892.1| Ribosomal protein S6e [Macleaya cordata] 64 3e-08 ref|XP_015890747.1| PREDICTED: 40S ribosomal protein S6 [Ziziphu... 64 4e-08 ref|XP_010247380.1| PREDICTED: 40S ribosomal protein S6-like [Ne... 64 5e-08 >ref|XP_008782167.1| PREDICTED: 40S ribosomal protein S6-like isoform X2 [Phoenix dactylifera] Length = 197 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 119 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 149 >ref|XP_021816386.1| 40S ribosomal protein S6 [Prunus avium] Length = 248 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 110 FFCPVGKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 F GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 166 FTSKTGKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_007205780.1| 40S ribosomal protein S6 [Prunus persica] ref|XP_008235060.1| PREDICTED: 40S ribosomal protein S6 [Prunus mume] gb|ONI02340.1| hypothetical protein PRUPE_6G192100 [Prunus persica] Length = 248 Score = 64.7 bits (156), Expect = 2e-08 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 110 FFCPVGKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 F GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 166 FTSKTGKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >gb|OVA15684.1| Ribosomal protein S6e [Macleaya cordata] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >gb|OUZ99608.1| Ribosomal protein S6e [Macleaya cordata] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_020695778.1| 40S ribosomal protein S6 [Dendrobium catenatum] gb|PKU71383.1| 40S ribosomal protein S6 [Dendrobium catenatum] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_020090000.1| 40S ribosomal protein S6-like isoform X2 [Ananas comosus] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_010937382.1| PREDICTED: 40S ribosomal protein S6 [Elaeis guineensis] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_010273001.1| PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_009380211.1| PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_009390279.1| PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_008804777.1| PREDICTED: 40S ribosomal protein S6 [Phoenix dactylifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_008790913.1| PREDICTED: 40S ribosomal protein S6 [Phoenix dactylifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_008782166.1| PREDICTED: 40S ribosomal protein S6-like isoform X1 [Phoenix dactylifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_002271632.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] emb|CBI34076.3| unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_002285752.1| PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] emb|CBI19191.3| unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_002273865.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] ref|XP_010652675.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] ref|XP_010652676.1| PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] ref|XP_010652677.1| PREDICTED: 40S ribosomal protein S6 isoform X2 [Vitis vinifera] emb|CBI33138.3| unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >gb|OVA02892.1| Ribosomal protein S6e [Macleaya cordata] Length = 250 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 201 >ref|XP_015890747.1| PREDICTED: 40S ribosomal protein S6 [Ziziphus jujuba] Length = 255 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK Sbjct: 179 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 209 >ref|XP_010247380.1| PREDICTED: 40S ribosomal protein S6-like [Nelumbo nucifera] Length = 249 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 GKKCSKAPKIQRLVTPLTLQRKRARIAEKKK 3 GKKCSKAPKIQRLVTPLTLQRKRAR+AEKKK Sbjct: 171 GKKCSKAPKIQRLVTPLTLQRKRARVAEKKK 201