BLASTX nr result
ID: Cheilocostus21_contig00044585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044585 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018673627.1| PREDICTED: QWRF motif-containing protein 3-l... 68 3e-10 ref|XP_018673626.1| PREDICTED: QWRF motif-containing protein 3-l... 68 3e-10 >ref|XP_018673627.1| PREDICTED: QWRF motif-containing protein 3-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 370 Score = 68.2 bits (165), Expect = 3e-10 Identities = 43/89 (48%), Positives = 54/89 (60%), Gaps = 8/89 (8%) Frame = +3 Query: 117 EHLTHERLLDPPAQIQPKKNGRRGSIHPATSGISSPQPLI--------RQLSRFKQEEED 272 +HL+ +RL D A+ PKKNG R +HP +G +SPQ I + SRFKQEE+D Sbjct: 63 DHLSDDRLRDLSAE--PKKNGGRRFLHPMAAGNASPQSTILGRQRSYSQYSSRFKQEEKD 120 Query: 273 VKKKKHNPNLKGDIPTTIGGSMRYIGEVI 359 KK + NLK +GGSMRYIGEVI Sbjct: 121 EMKKMRH-NLKVSSRPILGGSMRYIGEVI 148 >ref|XP_018673626.1| PREDICTED: QWRF motif-containing protein 3-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 385 Score = 68.2 bits (165), Expect = 3e-10 Identities = 43/89 (48%), Positives = 54/89 (60%), Gaps = 8/89 (8%) Frame = +3 Query: 117 EHLTHERLLDPPAQIQPKKNGRRGSIHPATSGISSPQPLI--------RQLSRFKQEEED 272 +HL+ +RL D A+ PKKNG R +HP +G +SPQ I + SRFKQEE+D Sbjct: 63 DHLSDDRLRDLSAE--PKKNGGRRFLHPMAAGNASPQSTILGRQRSYSQYSSRFKQEEKD 120 Query: 273 VKKKKHNPNLKGDIPTTIGGSMRYIGEVI 359 KK + NLK +GGSMRYIGEVI Sbjct: 121 EMKKMRH-NLKVSSRPILGGSMRYIGEVI 148