BLASTX nr result
ID: Cheilocostus21_contig00044242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044242 (516 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018675123.1| PREDICTED: dynamin-like protein ARC5 isoform... 72 1e-11 ref|XP_018675122.1| PREDICTED: dynamin-like protein ARC5 isoform... 72 1e-11 ref|XP_018675121.1| PREDICTED: dynamin-like protein ARC5 isoform... 72 1e-11 ref|XP_008781610.1| PREDICTED: dynamin-like protein ARC5 [Phoeni... 67 1e-09 ref|XP_010930711.1| PREDICTED: dynamin-like protein ARC5 [Elaeis... 67 1e-09 gb|OMO99099.1| hypothetical protein CCACVL1_03930 [Corchorus cap... 65 6e-09 gb|OMO86878.1| hypothetical protein COLO4_20871 [Corchorus olito... 65 6e-09 ref|XP_007043032.2| PREDICTED: dynamin-like protein ARC5 [Theobr... 65 6e-09 ref|XP_021280384.1| dynamin-like protein ARC5 [Herrania umbratica] 64 1e-08 ref|XP_022744144.1| dynamin-like protein ARC5 [Durio zibethinus] 64 2e-08 gb|EOX98863.1| P-loop containing nucleoside triphosphate hydrola... 64 2e-08 ref|XP_020106778.1| dynamin-like protein ARC5 [Ananas comosus] 64 2e-08 ref|XP_010269088.1| PREDICTED: dynamin-like protein ARC5 isoform... 63 3e-08 gb|OVA06144.1| Dynamin [Macleaya cordata] 63 3e-08 ref|XP_010269087.1| PREDICTED: dynamin-like protein ARC5 isoform... 63 3e-08 ref|XP_021993604.1| dynamin-like protein ARC5 [Helianthus annuus... 62 5e-08 ref|XP_011087835.1| dynamin-like protein ARC5 [Sesamum indicum] 62 5e-08 ref|XP_022876412.1| dynamin-like protein ARC5 [Olea europaea var... 62 7e-08 ref|XP_019249956.1| PREDICTED: dynamin-like protein ARC5 isoform... 62 7e-08 ref|XP_016462972.1| PREDICTED: dynamin-like protein ARC5 isoform... 62 7e-08 >ref|XP_018675123.1| PREDICTED: dynamin-like protein ARC5 isoform X3 [Musa acuminata subsp. malaccensis] Length = 714 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSY 394 FD+TQLRHSLGQRK+ EIELKRLQ+LKEKFR +NEQLSSY Sbjct: 670 FDITQLRHSLGQRKRELEIELKRLQRLKEKFREINEQLSSY 710 >ref|XP_018675122.1| PREDICTED: dynamin-like protein ARC5 isoform X2 [Musa acuminata subsp. malaccensis] Length = 749 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSY 394 FD+TQLRHSLGQRK+ EIELKRLQ+LKEKFR +NEQLSSY Sbjct: 705 FDITQLRHSLGQRKRELEIELKRLQRLKEKFREINEQLSSY 745 >ref|XP_018675121.1| PREDICTED: dynamin-like protein ARC5 isoform X1 [Musa acuminata subsp. malaccensis] Length = 788 Score = 72.4 bits (176), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSY 394 FD+TQLRHSLGQRK+ EIELKRLQ+LKEKFR +NEQLSSY Sbjct: 744 FDITQLRHSLGQRKRELEIELKRLQRLKEKFREINEQLSSY 784 >ref|XP_008781610.1| PREDICTED: dynamin-like protein ARC5 [Phoenix dactylifera] Length = 783 Score = 67.0 bits (162), Expect = 1e-09 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P*RFSALK 361 FD+TQLRHSLGQ K+ EIELKR+Q+LKEKFR +N+QL+S+ P R S +K Sbjct: 729 FDITQLRHSLGQCKRDLEIELKRIQRLKEKFREINQQLNSHQIWPKRISTVK 780 >ref|XP_010930711.1| PREDICTED: dynamin-like protein ARC5 [Elaeis guineensis] Length = 786 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P*RFSALK 361 FD+TQLRHSLGQ K+ EIELKR+Q+LKEKF+ +N QL+S+ P R S +K Sbjct: 732 FDITQLRHSLGQHKRDLEIELKRIQRLKEKFKEINHQLNSHQMQPKRISTVK 783 >gb|OMO99099.1| hypothetical protein CCACVL1_03930 [Corchorus capsularis] Length = 764 Score = 64.7 bits (156), Expect = 6e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P 382 FD+T LRHSLGQRK+ EIELKR++KLKEKF+V+++QLSS R P Sbjct: 712 FDITNLRHSLGQRKRDTEIELKRIKKLKEKFKVIHQQLSSCQRIP 756 >gb|OMO86878.1| hypothetical protein COLO4_20871 [Corchorus olitorius] Length = 764 Score = 64.7 bits (156), Expect = 6e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P 382 FD+T LRHSLGQRK+ EIELKR++KLKEKF+V+++QLSS R P Sbjct: 712 FDITNLRHSLGQRKRDTEIELKRIKKLKEKFKVIHQQLSSCQRIP 756 >ref|XP_007043032.2| PREDICTED: dynamin-like protein ARC5 [Theobroma cacao] Length = 764 Score = 64.7 bits (156), Expect = 6e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P 382 FD+T LRHSLGQRK+ EIELKR+++LKEKFRV+++QLSS R P Sbjct: 712 FDITNLRHSLGQRKRDTEIELKRIKRLKEKFRVIHQQLSSCQRIP 756 >ref|XP_021280384.1| dynamin-like protein ARC5 [Herrania umbratica] Length = 764 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHSLGQ+K+ EIELKR+++LKEKFRV+N+QLSS Sbjct: 712 FDITNLRHSLGQQKRDTEIELKRIKRLKEKFRVINQQLSS 751 >ref|XP_022744144.1| dynamin-like protein ARC5 [Durio zibethinus] Length = 763 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR*P 382 FD+T LRHSLGQRK+ EIELKR+++LKEKF+V+++QLSS R P Sbjct: 712 FDITNLRHSLGQRKRDTEIELKRIKRLKEKFKVIHQQLSSCQRIP 756 >gb|EOX98863.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] Length = 764 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHSLGQRK+ EIELKR+++LKEKFRV+++QLSS Sbjct: 712 FDITNLRHSLGQRKRDTEIELKRIKRLKEKFRVIHQQLSS 751 >ref|XP_020106778.1| dynamin-like protein ARC5 [Ananas comosus] Length = 781 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSY 394 FDVTQ+RH LGQ+K+ EIELKR+Q+LKEKFR +NE+L+S+ Sbjct: 727 FDVTQMRHKLGQQKRELEIELKRIQRLKEKFREINEKLNSH 767 >ref|XP_010269088.1| PREDICTED: dynamin-like protein ARC5 isoform X2 [Nelumbo nucifera] Length = 688 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR 388 FD+T LR SLGQRK FE+ELKR+Q+LKEKFR ++EQL+S R Sbjct: 646 FDITHLRRSLGQRKHDFEVELKRIQRLKEKFRRIHEQLNSRIR 688 >gb|OVA06144.1| Dynamin [Macleaya cordata] Length = 760 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHSLGQ+K+ EIELKR+ KLKEKFR ++EQLSS Sbjct: 717 FDITHLRHSLGQQKREMEIELKRINKLKEKFRQIHEQLSS 756 >ref|XP_010269087.1| PREDICTED: dynamin-like protein ARC5 isoform X1 [Nelumbo nucifera] Length = 761 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSSYFR 388 FD+T LR SLGQRK FE+ELKR+Q+LKEKFR ++EQL+S R Sbjct: 719 FDITHLRRSLGQRKHDFEVELKRIQRLKEKFRRIHEQLNSRIR 761 >ref|XP_021993604.1| dynamin-like protein ARC5 [Helianthus annuus] gb|OTG08078.1| putative P-loop containing nucleoside triphosphate hydrolases superfamily protein [Helianthus annuus] Length = 729 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLS 400 FD+T LRHSLGQRK+ EIE+KR+QKLK+KFR ++EQLS Sbjct: 683 FDITNLRHSLGQRKRETEIEMKRIQKLKDKFRKIHEQLS 721 >ref|XP_011087835.1| dynamin-like protein ARC5 [Sesamum indicum] Length = 768 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T +RHSLGQRK+ EIELKR+Q+LKEKFR ++EQL+S Sbjct: 722 FDITTMRHSLGQRKRETEIELKRIQRLKEKFRQIHEQLTS 761 >ref|XP_022876412.1| dynamin-like protein ARC5 [Olea europaea var. sylvestris] Length = 606 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHSLGQRK+ EIELKR+Q+LKEKFR +++QL+S Sbjct: 539 FDITNLRHSLGQRKRETEIELKRIQRLKEKFRQIHKQLNS 578 >ref|XP_019249956.1| PREDICTED: dynamin-like protein ARC5 isoform X2 [Nicotiana attenuata] Length = 735 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHS+GQ+K+ EIELKR+QKLKEKFR ++EQL+S Sbjct: 689 FDITNLRHSVGQQKRQTEIELKRVQKLKEKFRYIHEQLNS 728 >ref|XP_016462972.1| PREDICTED: dynamin-like protein ARC5 isoform X2 [Nicotiana tabacum] Length = 735 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 516 FDVTQLRHSLGQRKQAFEIELKRLQKLKEKFRVVNEQLSS 397 FD+T LRHS+GQ+K+ EIELKR+QKLKEKFR ++EQL+S Sbjct: 689 FDITNLRHSVGQQKRQTEIELKRVQKLKEKFRYIHEQLNS 728