BLASTX nr result
ID: Cheilocostus21_contig00044115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044115 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_082197621.1| hypothetical protein [Enterococcus faecium] 55 7e-07 >ref|WP_082197621.1| hypothetical protein [Enterococcus faecium] Length = 63 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = -1 Query: 169 LKEKVTGSKQISTSSLHILFTLDDSKFWKKLERAERSEERRVGKECRSRWSPYH 8 LK + + +LH++ L+ + KL RSEERRVGKECRSRWSPYH Sbjct: 10 LKNYTINEDEWAYLALHLMAALEKERAAHKLHALIRSEERRVGKECRSRWSPYH 63