BLASTX nr result
ID: Cheilocostus21_contig00044113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00044113 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417330.1| PREDICTED: uncharacterized CRM domain-contai... 58 1e-06 >ref|XP_009417330.1| PREDICTED: uncharacterized CRM domain-containing protein At3g25440, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 368 Score = 57.8 bits (138), Expect = 1e-06 Identities = 39/96 (40%), Positives = 53/96 (55%), Gaps = 6/96 (6%) Frame = -3 Query: 272 VRLPNPRRARNSLFSFIGHYPVDCVMQKPRCMCVSHSSL------RAYSNLIVKVTASSP 111 + L NP R + + S G+Y ++ RC C+S S+ R Y ++ S Sbjct: 28 IPLSNPTRT-SLVGSRNGYYLMNWTSHMHRCTCISRLSMCTCSGPRGYKDM-----PFSS 81 Query: 110 QWSVSSLVHHKTHPYSPCSLQRWQSIRFRSNALVTL 3 VSSL++HK Y+P + QRWQSIRFRSNALVTL Sbjct: 82 CVLVSSLIYHKPIIYNPFNPQRWQSIRFRSNALVTL 117