BLASTX nr result
ID: Cheilocostus21_contig00043963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043963 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404341.1| PREDICTED: protein MKS1-like [Musa acuminata... 64 5e-09 >ref|XP_009404341.1| PREDICTED: protein MKS1-like [Musa acuminata subsp. malaccensis] Length = 233 Score = 63.9 bits (154), Expect = 5e-09 Identities = 35/52 (67%), Positives = 35/52 (67%), Gaps = 10/52 (19%) Frame = +1 Query: 1 SPVLPN--NTANNN--------FWVSPLNNLLSTPTVPSPGAFWELLNQFPD 126 SPVL N N NN F SP NNLLSTPTVPSPGAFWELLNQFPD Sbjct: 181 SPVLANKSNVDGNNRSFMDGGSFLASPSNNLLSTPTVPSPGAFWELLNQFPD 232