BLASTX nr result
ID: Cheilocostus21_contig00043940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043940 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP48364.1| hypothetical protein KK1_029976 [Cajanus cajan] 56 4e-06 >gb|KYP48364.1| hypothetical protein KK1_029976 [Cajanus cajan] Length = 449 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -1 Query: 129 YFSLC-SVWCRRTDELVDGPNASQITSSSLDSHRSKAVSVVQ 7 Y S C SVWCRRTDELVDGPNASQIT ++LD S+ V Q Sbjct: 183 YISPCFSVWCRRTDELVDGPNASQITPTALDRWESRLEEVFQ 224