BLASTX nr result
ID: Cheilocostus21_contig00043843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043843 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009410162.2| PREDICTED: lysine-rich arabinogalactan prote... 63 5e-09 >ref|XP_009410162.2| PREDICTED: lysine-rich arabinogalactan protein 19-like [Musa acuminata subsp. malaccensis] Length = 225 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 169 MAREAAESKPIGVCEKLFNAFNFNPSFRPLRRLTVREHSDAGDH 38 MA++AA+SKP+GVCE+LFNA +FN +FRPLRRLT + DH Sbjct: 37 MAKDAADSKPLGVCERLFNALSFNAAFRPLRRLTFHKQPATADH 80