BLASTX nr result
ID: Cheilocostus21_contig00043657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043657 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY43416.1| hypothetical protein CUMW_074290 [Citrus unshiu]... 60 1e-08 gb|PKI49511.1| hypothetical protein CRG98_030128 [Punica granatum] 60 1e-08 gb|OMO80961.1| hypothetical protein COLO4_23838 [Corchorus olito... 60 1e-08 gb|OAY56617.1| hypothetical protein MANES_02G031800 [Manihot esc... 60 1e-08 ref|XP_016736980.1| PREDICTED: ycf49-like protein [Gossypium hir... 60 1e-08 ref|XP_015901595.1| PREDICTED: ycf49-like protein [Ziziphus jujuba] 60 1e-08 ref|XP_024173629.1| uncharacterized protein LOC112179443 isoform... 60 2e-08 ref|XP_018847431.1| PREDICTED: uncharacterized protein LOC109010... 60 2e-08 ref|XP_011463785.1| PREDICTED: uncharacterized protein LOC101306... 60 2e-08 gb|PHT92573.1| Ycf49-like protein [Capsicum annuum] 60 3e-08 gb|KYP67217.1| Ycf49-like protein [Cajanus cajan] 60 3e-08 emb|CBI34804.3| unnamed protein product, partial [Vitis vinifera] 60 4e-08 ref|XP_021293771.1| uncharacterized protein LOC110423747 isoform... 60 4e-08 ref|XP_021605691.1| uncharacterized protein LOC110610131, partia... 60 4e-08 gb|EEF51027.1| conserved hypothetical protein [Ricinus communis] 59 5e-08 gb|KRH27998.1| hypothetical protein GLYMA_11G028600 [Glycine max] 60 5e-08 ref|XP_020217334.1| uncharacterized protein LOC109800843 [Cajanu... 60 6e-08 ref|XP_014520258.1| uncharacterized protein LOC106777217 [Vigna ... 60 6e-08 ref|XP_007158422.1| hypothetical protein PHAVU_002G151800g [Phas... 60 7e-08 gb|KRH27999.1| hypothetical protein GLYMA_11G028600 [Glycine max... 60 7e-08 >dbj|GAY43416.1| hypothetical protein CUMW_074290 [Citrus unshiu] dbj|GAY43417.1| hypothetical protein CUMW_074290 [Citrus unshiu] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >gb|PKI49511.1| hypothetical protein CRG98_030128 [Punica granatum] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >gb|OMO80961.1| hypothetical protein COLO4_23838 [Corchorus olitorius] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >gb|OAY56617.1| hypothetical protein MANES_02G031800 [Manihot esculenta] gb|OAY56618.1| hypothetical protein MANES_02G031800 [Manihot esculenta] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >ref|XP_016736980.1| PREDICTED: ycf49-like protein [Gossypium hirsutum] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >ref|XP_015901595.1| PREDICTED: ycf49-like protein [Ziziphus jujuba] Length = 81 Score = 59.7 bits (143), Expect = 1e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNSESLEV 47 >ref|XP_024173629.1| uncharacterized protein LOC112179443 isoform X2 [Rosa chinensis] Length = 99 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 41 MVPLLGGAFCACTWHFFYNSESLEV 65 >ref|XP_018847431.1| PREDICTED: uncharacterized protein LOC109010902 isoform X2 [Juglans regia] Length = 99 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 41 MVPLLGGAFCACTWHFFYNSESLEV 65 >ref|XP_011463785.1| PREDICTED: uncharacterized protein LOC101306233 isoform X3 [Fragaria vesca subsp. vesca] Length = 99 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 41 MVPLLGGAFCACTWHFFYNSESLEV 65 >gb|PHT92573.1| Ycf49-like protein [Capsicum annuum] Length = 122 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 69 MVPLLGGAFCACTWHFFYNSESLEV 93 >gb|KYP67217.1| Ycf49-like protein [Cajanus cajan] Length = 122 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 68 MVPLLGGAFCACTWHFFYNSESLEV 92 >emb|CBI34804.3| unnamed protein product, partial [Vitis vinifera] Length = 137 Score = 59.7 bits (143), Expect = 4e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 79 MVPLLGGAFCACTWHFFYNSESLEV 103 >ref|XP_021293771.1| uncharacterized protein LOC110423747 isoform X2 [Herrania umbratica] Length = 177 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEVC*TSSPCYL-CL 429 MVPLLGGAFCACTWHFFYNSESLEV ++ Y+ CL Sbjct: 131 MVPLLGGAFCACTWHFFYNSESLEVMTFATHSYMFCL 167 >ref|XP_021605691.1| uncharacterized protein LOC110610131, partial [Manihot esculenta] Length = 145 Score = 59.7 bits (143), Expect = 4e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 87 MVPLLGGAFCACTWHFFYNSESLEV 111 >gb|EEF51027.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 58.5 bits (140), Expect = 5e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYN+ESLEV Sbjct: 23 MVPLLGGAFCACTWHFFYNAESLEV 47 >gb|KRH27998.1| hypothetical protein GLYMA_11G028600 [Glycine max] Length = 152 Score = 59.7 bits (143), Expect = 5e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 116 MVPLLGGAFCACTWHFFYNSESLEV 140 >ref|XP_020217334.1| uncharacterized protein LOC109800843 [Cajanus cajan] Length = 162 Score = 59.7 bits (143), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 108 MVPLLGGAFCACTWHFFYNSESLEV 132 >ref|XP_014520258.1| uncharacterized protein LOC106777217 [Vigna radiata var. radiata] Length = 166 Score = 59.7 bits (143), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 112 MVPLLGGAFCACTWHFFYNSESLEV 136 >ref|XP_007158422.1| hypothetical protein PHAVU_002G151800g [Phaseolus vulgaris] gb|ESW30416.1| hypothetical protein PHAVU_002G151800g [Phaseolus vulgaris] Length = 168 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 114 MVPLLGGAFCACTWHFFYNSESLEV 138 >gb|KRH27999.1| hypothetical protein GLYMA_11G028600 [Glycine max] gb|KRH28000.1| hypothetical protein GLYMA_11G028600 [Glycine max] Length = 170 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 536 MVPLLGGAFCACTWHFFYNSESLEV 462 MVPLLGGAFCACTWHFFYNSESLEV Sbjct: 116 MVPLLGGAFCACTWHFFYNSESLEV 140