BLASTX nr result
ID: Cheilocostus21_contig00043607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043607 (867 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010940062.1| PREDICTED: uncharacterized protein LOC105058... 59 2e-07 >ref|XP_010940062.1| PREDICTED: uncharacterized protein LOC105058738 [Elaeis guineensis] Length = 133 Score = 59.3 bits (142), Expect = 2e-07 Identities = 35/74 (47%), Positives = 45/74 (60%), Gaps = 11/74 (14%) Frame = +2 Query: 122 MTTVAQPM-APPHNVXXXXXXXXXXXFGPVFIVLGAIAVLAVISCVIGRLCSRR------ 280 M+++ QPM A PH++ FGPVFIVL IAVLA I+CV+GRLC+RR Sbjct: 1 MSSLPQPMVAYPHSISTQPSSYSKGSFGPVFIVLAIIAVLATIACVVGRLCARRLSQPKL 60 Query: 281 ---HRSH-GGGDVE 310 HRS+ GD+E Sbjct: 61 RHEHRSYTAKGDIE 74