BLASTX nr result
ID: Cheilocostus21_contig00043500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043500 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400359.1| PREDICTED: ACT domain-containing protein ACR... 59 3e-07 >ref|XP_009400359.1| PREDICTED: ACT domain-containing protein ACR8-like [Musa acuminata subsp. malaccensis] Length = 457 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +2 Query: 5 EPRAAPPCDDHSQAEAAGAVGGFNLGNLVMRNFYFLGLVRSCS 133 E R PC + EAAG VG F+LGNLVMRN Y+LGL+RSCS Sbjct: 415 EQRGPRPCQERPLPEAAGVVGVFSLGNLVMRNLYYLGLIRSCS 457