BLASTX nr result
ID: Cheilocostus21_contig00043468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043468 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018676144.1| PREDICTED: pentatricopeptide repeat-containi... 149 3e-38 ref|XP_010931310.1| PREDICTED: pentatricopeptide repeat-containi... 112 2e-25 ref|XP_019706448.1| PREDICTED: pentatricopeptide repeat-containi... 111 4e-25 ref|XP_017698757.1| PREDICTED: pentatricopeptide repeat-containi... 109 2e-24 ref|XP_017700061.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-22 ref|XP_020081135.1| pentatricopeptide repeat-containing protein ... 101 9e-22 gb|OAY62564.1| Pentatricopeptide repeat-containing protein, chlo... 101 1e-21 ref|XP_020102052.1| pentatricopeptide repeat-containing protein ... 100 2e-21 ref|XP_020671998.1| pentatricopeptide repeat-containing protein ... 79 6e-14 ref|XP_020578245.1| pentatricopeptide repeat-containing protein ... 75 1e-12 ref|XP_020578243.1| pentatricopeptide repeat-containing protein ... 75 1e-12 ref|XP_010269879.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-11 gb|PKA67251.1| Pentatricopeptide repeat-containing protein [Apos... 70 7e-11 ref|XP_010274574.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-10 gb|KVH91608.1| hypothetical protein Ccrd_006367 [Cynara carduncu... 67 1e-09 emb|CBI29222.3| unnamed protein product, partial [Vitis vinifera] 63 2e-08 ref|XP_010644689.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_023770611.1| pentatricopeptide repeat-containing protein ... 63 3e-08 ref|XP_021598224.1| pentatricopeptide repeat-containing protein ... 62 8e-08 ref|XP_021683694.1| pentatricopeptide repeat-containing protein ... 61 1e-07 >ref|XP_018676144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_018676145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_018676146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Musa acuminata subsp. malaccensis] ref|XP_018676147.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Musa acuminata subsp. malaccensis] Length = 809 Score = 149 bits (375), Expect = 3e-38 Identities = 81/138 (58%), Positives = 89/138 (64%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R +LS LLS A FD ALCRETLS + PRRLER LLD+RSSL P+PALRFFSFATDHCG Sbjct: 46 LRRSLSLLLSPAPFDAALCRETLSRICPRRLERLLLDLRSSL-HPEPALRFFSFATDHCG 104 Query: 235 FSFTPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTA 56 F FTPRAYAL+LH F EI+HA+ADT Sbjct: 105 FIFTPRAYALILHSLFRSNLASAARVLLLRILDARAAVPLFLDDPDHWFSEIIHALADTV 164 Query: 55 PSSDSPAFDLLVHLCCTQ 2 PSSDSPA DLLVHLCCTQ Sbjct: 165 PSSDSPAIDLLVHLCCTQ 182 >ref|XP_010931310.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] ref|XP_010931311.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] ref|XP_010931312.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] ref|XP_010931313.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] ref|XP_010931314.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] ref|XP_019708947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] Length = 824 Score = 112 bits (279), Expect = 2e-25 Identities = 64/142 (45%), Positives = 84/142 (59%), Gaps = 4/142 (2%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R NLS LLS + D LCRETL+ LSPRRL+ LLD+R ++ RP+PALRFFSFA++ CG Sbjct: 35 LRRNLSLLLSRPSIDADLCRETLARLSPRRLDILLLDLRPAI-RPRPALRFFSFASERCG 93 Query: 235 FSFTPRAYALLLH--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIAD 62 F FTPR+Y++L+H RFPEIV A+A+ Sbjct: 94 FCFTPRSYSILVHALLRSNLAAAARLLLIRLIGGGTSGSLPVLLDDPSRRFPEIVRALAE 153 Query: 61 TAPSSDSP--AFDLLVHLCCTQ 2 T + ++P A D LVH+CCTQ Sbjct: 154 TVSADETPSGALDTLVHVCCTQ 175 >ref|XP_019706448.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Elaeis guineensis] Length = 845 Score = 111 bits (277), Expect = 4e-25 Identities = 64/142 (45%), Positives = 82/142 (57%), Gaps = 4/142 (2%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R NL+ LLS + D LCRETL+ LSP RL+R LLD+R ++ +P+PALRFFSFA+D CG Sbjct: 51 LRRNLALLLSRPSLDATLCRETLARLSPGRLDRLLLDLRPAI-KPRPALRFFSFASDRCG 109 Query: 235 FSFTPRAYALLLH--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIAD 62 F FTPR+Y+LL+H RF EIV A+AD Sbjct: 110 FRFTPRSYSLLVHALLRSNHVAAARLLLIRLIGGGTGSNLPLLLDDPSHRFAEIVRAVAD 169 Query: 61 TAPSSDSP--AFDLLVHLCCTQ 2 T + + P A D LVH+CCTQ Sbjct: 170 TVSADEPPSGALDTLVHVCCTQ 191 >ref|XP_017698757.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Phoenix dactylifera] Length = 841 Score = 109 bits (273), Expect = 2e-24 Identities = 62/142 (43%), Positives = 83/142 (58%), Gaps = 4/142 (2%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R +L+ LLS + D LCRETL+ LSPR L+R LLD+R ++ +P+PALRFFSFA+ HCG Sbjct: 47 LRRDLALLLSRPSIDADLCRETLARLSPRLLDRLLLDLRPAI-KPRPALRFFSFASGHCG 105 Query: 235 FSFTPRAYALLLH--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIAD 62 F FTPR+Y++L+H RFPEIV ++AD Sbjct: 106 FCFTPRSYSILVHALLRSNLAAPARLLLIRLISGGAGGSLPLLLDDPSRRFPEIVRSLAD 165 Query: 61 TAPSSDSP--AFDLLVHLCCTQ 2 T + + P A D LVH+CCTQ Sbjct: 166 TVSADEPPSGALDTLVHVCCTQ 187 >ref|XP_017700061.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Phoenix dactylifera] Length = 803 Score = 102 bits (254), Expect = 5e-22 Identities = 62/142 (43%), Positives = 78/142 (54%), Gaps = 4/142 (2%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R NL+ LLS D LCRETL+ LSP RL+ LLD+R ++ +P+PALRFFSFA+D CG Sbjct: 51 LRRNLALLLSRPFLDATLCRETLARLSPCRLDSLLLDLRPAI-KPRPALRFFSFASDRCG 109 Query: 235 FSFTPRAYALLLH--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIAD 62 F FT R+Y+LL+H RF E+V A+AD Sbjct: 110 FRFTSRSYSLLVHALLRSNLVAAARLLLIRLIGSGAGSNLPLLLDDPSHRFAEVVRAVAD 169 Query: 61 T--APSSDSPAFDLLVHLCCTQ 2 T A S A D LVH+CCTQ Sbjct: 170 TISADEPSSGALDTLVHVCCTQ 191 >ref|XP_020081135.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like, partial [Ananas comosus] Length = 585 Score = 101 bits (252), Expect = 9e-22 Identities = 65/148 (43%), Positives = 76/148 (51%), Gaps = 10/148 (6%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R +L+ LLS D ALCR TLS L PRRLE LL++R +L RPKPALR FS A D G Sbjct: 206 LRHDLAALLSRRDLDPALCRATLSRLPPRRLEALLLELRPAL-RPKPALRLFSLAADRLG 264 Query: 235 FSFTPRAYALLLH-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIV 77 F FTPR+YALLL RF E+V Sbjct: 265 FRFTPRSYALLLDSLLRSDPRAPAAPARLLLARLLDPVNGAPLLLLDGNDDPSRRFTELV 324 Query: 76 HAIADTAPSSDSP---AFDLLVHLCCTQ 2 AIADT P D+P + D LVH+CCTQ Sbjct: 325 RAIADTVPPQDAPFAASIDALVHVCCTQ 352 >gb|OAY62564.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 844 Score = 101 bits (252), Expect = 1e-21 Identities = 65/148 (43%), Positives = 76/148 (51%), Gaps = 10/148 (6%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 +R +L+ LLS D ALCR TLS L PRRLE LL++R +L RPKPALR FS A D G Sbjct: 44 LRHDLAALLSRRDLDPALCRATLSRLPPRRLEALLLELRPAL-RPKPALRLFSLAADRLG 102 Query: 235 FSFTPRAYALLLH-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIV 77 F FTPR+YALLL RF E+V Sbjct: 103 FRFTPRSYALLLDSLLRSDPRAPAAPARLLLARLLDPVNGAPLLLLDGNDDPSRRFTELV 162 Query: 76 HAIADTAPSSDSP---AFDLLVHLCCTQ 2 AIADT P D+P + D LVH+CCTQ Sbjct: 163 RAIADTVPPQDAPFAASIDALVHVCCTQ 190 >ref|XP_020102052.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Ananas comosus] Length = 804 Score = 100 bits (249), Expect = 2e-21 Identities = 64/141 (45%), Positives = 72/141 (51%), Gaps = 10/141 (7%) Frame = -1 Query: 394 LLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFTPRA 215 LLS D ALCR TLS L PRRLE LL++R +L RPKPALR FSFA D GF FTPR+ Sbjct: 11 LLSRRDLDPALCRATLSRLPPRRLEALLLELRPAL-RPKPALRLFSFAADRLGFRFTPRS 69 Query: 214 YALLLH-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTA 56 YALLL RF E+V AIADT Sbjct: 70 YALLLDSLLRSDPRAPAAPARLLLARLLDPVNGAPLLLLDGNDDPSRRFTELVRAIADTV 129 Query: 55 PSSDSP---AFDLLVHLCCTQ 2 P D+P + D LVH+CCTQ Sbjct: 130 PPQDAPFAASIDALVHVCCTQ 150 >ref|XP_020671998.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] ref|XP_020671999.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] ref|XP_020672000.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] ref|XP_020672001.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] ref|XP_020672002.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] ref|XP_020672003.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Dendrobium catenatum] gb|PKU71344.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 821 Score = 79.3 bits (194), Expect = 6e-14 Identities = 52/136 (38%), Positives = 69/136 (50%), Gaps = 1/136 (0%) Frame = -1 Query: 406 NLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSF 227 +L LLS +F+ +LCR+ LS LSPRR E L + S+ ALRFFSFA+D CGFSF Sbjct: 52 DLHLLLSRPSFNPSLCRQILSSLSPRRCEVLLTQLLPSV-PVNVALRFFSFASDQCGFSF 110 Query: 226 TPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTA-PS 50 T R+Y+LLLH R E+V A+ +A P Sbjct: 111 TLRSYSLLLHSLLSSGLVTPARLFLIRLLDPSSSLPVIFDVQDRRLHELVEALTVSAPPE 170 Query: 49 SDSPAFDLLVHLCCTQ 2 + A D+LVH+C +Q Sbjct: 171 TTQMAIDVLVHVCASQ 186 >ref|XP_020578245.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Phalaenopsis equestris] Length = 779 Score = 75.5 bits (184), Expect = 1e-12 Identities = 51/132 (38%), Positives = 63/132 (47%), Gaps = 1/132 (0%) Frame = -1 Query: 394 LLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFTPRA 215 LLS +F+ ++CR LS LSPRR E L + S+ AL FFSFA+D C FSFT R+ Sbjct: 58 LLSRPSFNHSICRRLLSRLSPRRCEVLLTQLLPSV-PINVALSFFSFASDQCRFSFTLRS 116 Query: 214 YALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAP-SSDSP 38 YALLLH R E+ A+ AP S P Sbjct: 117 YALLLHSLLSSGMATPARLLLIRLLDPSSSLPVFIDDQDRRLHELFDALTVAAPQDSIQP 176 Query: 37 AFDLLVHLCCTQ 2 A D+LVH+C TQ Sbjct: 177 AIDMLVHVCVTQ 188 >ref|XP_020578243.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Phalaenopsis equestris] Length = 809 Score = 75.5 bits (184), Expect = 1e-12 Identities = 51/132 (38%), Positives = 63/132 (47%), Gaps = 1/132 (0%) Frame = -1 Query: 394 LLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFTPRA 215 LLS +F+ ++CR LS LSPRR E L + S+ AL FFSFA+D C FSFT R+ Sbjct: 58 LLSRPSFNHSICRRLLSRLSPRRCEVLLTQLLPSV-PINVALSFFSFASDQCRFSFTLRS 116 Query: 214 YALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAP-SSDSP 38 YALLLH R E+ A+ AP S P Sbjct: 117 YALLLHSLLSSGMATPARLLLIRLLDPSSSLPVFIDDQDRRLHELFDALTVAAPQDSIQP 176 Query: 37 AFDLLVHLCCTQ 2 A D+LVH+C TQ Sbjct: 177 AIDMLVHVCVTQ 188 >ref|XP_010269879.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Nelumbo nucifera] ref|XP_010269880.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Nelumbo nucifera] Length = 854 Score = 72.0 bits (175), Expect = 2e-11 Identities = 48/138 (34%), Positives = 65/138 (47%) Frame = -1 Query: 415 VRGNLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCG 236 + ++ +LS+ + D + CRE L HLSP +R D+R S+ PK AL FF+FA+ G Sbjct: 54 ILNKVASILSNKSLDTSKCREVLCHLSPHHFDRLFFDMRDSV-NPKTALNFFTFASQSLG 112 Query: 235 FSFTPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTA 56 F FT R+Y LL+ R EI AIA + Sbjct: 113 FRFTVRSYCLLI--SLLVGSNTIVPARLLLIRLIDGNVPVIFDNRNDRHLEIARAIAGS- 169 Query: 55 PSSDSPAFDLLVHLCCTQ 2 SS + FDLLVH+ CTQ Sbjct: 170 -SSTTSVFDLLVHVYCTQ 186 >gb|PKA67251.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 844 Score = 70.5 bits (171), Expect = 7e-11 Identities = 49/136 (36%), Positives = 64/136 (47%), Gaps = 1/136 (0%) Frame = -1 Query: 406 NLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSF 227 +L LLS +FD +LCR LS L RLE L + ++ K ALRFFSFA+D C F F Sbjct: 52 DLHLLLSRPSFDPSLCRHLLSSLPSHRLEVLLPRILPTV-PIKLALRFFSFASDQCSFRF 110 Query: 226 TPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAI-ADTAPS 50 T R+Y+LL++ R E+V A+ A T P Sbjct: 111 TARSYSLLIYLLLKSGLVRPARLLLSRLLDPSSSLPVLSDVPDRRLEEVVAALTASTPPE 170 Query: 49 SDSPAFDLLVHLCCTQ 2 + A D LVH+C TQ Sbjct: 171 AAQAAVDALVHVCTTQ 186 >ref|XP_010274574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Nelumbo nucifera] ref|XP_010274575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Nelumbo nucifera] Length = 856 Score = 68.9 bits (167), Expect = 2e-10 Identities = 45/134 (33%), Positives = 64/134 (47%) Frame = -1 Query: 403 LSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFT 224 ++ +LSS + D + CRE LSH+SP + ++RSS PK AL FF+FA+ GF FT Sbjct: 60 VTSILSSKSLDTSKCREALSHISPHHFDHIFFELRSST-NPKTALNFFTFASQSVGFRFT 118 Query: 223 PRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAPSSD 44 R+Y +L++ R EI A+ D+ +S Sbjct: 119 VRSYCILIN--LLVGSNLIFPARLLLIRLIDGNVPALFEKPNDRHLEIAQAVIDS--NSA 174 Query: 43 SPAFDLLVHLCCTQ 2 FDLLVH+ CTQ Sbjct: 175 VSTFDLLVHVYCTQ 188 >gb|KVH91608.1| hypothetical protein Ccrd_006367 [Cynara cardunculus var. scolymus] Length = 822 Score = 66.6 bits (161), Expect = 1e-09 Identities = 41/138 (29%), Positives = 67/138 (48%), Gaps = 4/138 (2%) Frame = -1 Query: 403 LSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFT 224 ++ +LS+ + D + C++ ++HLSP++ + D+R S+ +P+ AL FF FA+ CGF FT Sbjct: 49 VTSILSNPSLDSSKCKDIVTHLSPQQFDSVFSDIRCSV-KPRTALNFFYFASKSCGFKFT 107 Query: 223 PRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAPSSD 44 + Y LL+H +R E+ A D +S+ Sbjct: 108 LKTYCLLIH--LLVVSKLASPARLVLIQLIDDKLPVLVHDPKNRHTEMATAFIDLQLTSE 165 Query: 43 S----PAFDLLVHLCCTQ 2 S FDLL+H+ CTQ Sbjct: 166 SVFGLQTFDLLIHVYCTQ 183 >emb|CBI29222.3| unnamed protein product, partial [Vitis vinifera] Length = 826 Score = 63.2 bits (152), Expect = 2e-08 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 4/139 (2%) Frame = -1 Query: 406 NLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSF 227 +++ +LS+ + D C++ + HLSP + + VR ++ PK AL FF FA+D CGF F Sbjct: 52 SVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNV-NPKTALNFFYFASDSCGFRF 110 Query: 226 TPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAPSS 47 T R+Y +L+ +R EI A+AD Sbjct: 111 TLRSYCVLMR--SLIVSGFVSPARLLLIRLIDRKLPVLFGDPKNRHIEIASAMADLNEVG 168 Query: 46 DS----PAFDLLVHLCCTQ 2 +S A DLL+H+ CTQ Sbjct: 169 ESGVAVAAVDLLIHVYCTQ 187 >ref|XP_010644689.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Vitis vinifera] ref|XP_010644698.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Vitis vinifera] ref|XP_010644702.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Vitis vinifera] ref|XP_019081061.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Vitis vinifera] ref|XP_019081063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Vitis vinifera] Length = 842 Score = 63.2 bits (152), Expect = 2e-08 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 4/139 (2%) Frame = -1 Query: 406 NLSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSF 227 +++ +LS+ + D C++ + HLSP + + VR ++ PK AL FF FA+D CGF F Sbjct: 68 SVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNV-NPKTALNFFYFASDSCGFRF 126 Query: 226 TPRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAPSS 47 T R+Y +L+ +R EI A+AD Sbjct: 127 TLRSYCVLMR--SLIVSGFVSPARLLLIRLIDRKLPVLFGDPKNRHIEIASAMADLNEVG 184 Query: 46 DS----PAFDLLVHLCCTQ 2 +S A DLL+H+ CTQ Sbjct: 185 ESGVAVAAVDLLIHVYCTQ 203 >ref|XP_023770611.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Lactuca sativa] ref|XP_023770612.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Lactuca sativa] Length = 820 Score = 62.8 bits (151), Expect = 3e-08 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 3/137 (2%) Frame = -1 Query: 403 LSRLLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFT 224 ++ +LS+ + D + C++ ++HLSP++ + D+R S+ +P+ AL FF FA+ CGF F+ Sbjct: 49 VTSILSNPSLDSSKCKDIVTHLSPQQFDCVFCDIRYSV-KPRTALNFFYFASRSCGFKFS 107 Query: 223 PRAYALLLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRFPEIVHAIADTAPSSD 44 ++Y LL+H ++ EI + +SD Sbjct: 108 IKSYCLLIH--LLVGSKLESPARLLLIQLIDDKLPVLLHDPKTKHIEIATLFMEFHFTSD 165 Query: 43 S---PAFDLLVHLCCTQ 2 + P FDLL+H+ CTQ Sbjct: 166 ALPLPTFDLLIHVYCTQ 182 >ref|XP_021598224.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598225.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598226.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598227.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598229.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598230.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598231.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598232.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] ref|XP_021598233.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Manihot esculenta] gb|OAY24325.1| hypothetical protein MANES_17G006200 [Manihot esculenta] Length = 838 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = -1 Query: 394 LLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFTPRA 215 +LS+++FD + CR+ L HL P +R + S++ PK AL+FF FA+D C + FT R+ Sbjct: 62 ILSNSSFDSSKCRQLLPHLCPHEFDRCFFAIESNV-NPKTALKFFQFASDTCQYRFTVRS 120 Query: 214 YALLL 200 Y LL+ Sbjct: 121 YCLLI 125 >ref|XP_021683694.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683695.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683696.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683697.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683698.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683699.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683700.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683701.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] ref|XP_021683702.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic isoform X1 [Hevea brasiliensis] Length = 834 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = -1 Query: 394 LLSSATFDDALCRETLSHLSPRRLERHLLDVRSSLLRPKPALRFFSFATDHCGFSFTPRA 215 +LS+++FD + CR+ L HL P +R L + S++ P+ AL FF FA+D C F FT R+ Sbjct: 62 ILSNSSFDSSKCRQLLPHLCPHEFDRCFLAIGSNV-NPRTALHFFHFASDTCKFRFTVRS 120 Query: 214 YALLL 200 Y LL+ Sbjct: 121 YCLLI 125