BLASTX nr result
ID: Cheilocostus21_contig00043418
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043418 (712 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGW45949.1| NADH-plastoquinone oxidoreductase subunit 1 (plas... 55 5e-06 >gb|AGW45949.1| NADH-plastoquinone oxidoreductase subunit 1 (plastid) [Lens culinaris] Length = 151 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -1 Query: 271 QLNK-YSIMGDQI*MTWIL*AS*FNSIYT*ASQFSTPRMRMDQLLNLGWKFLLPISLGN 98 ++NK Y + G I + L S F + +++S PR+RMDQLLNLGWKFLLP+SLGN Sbjct: 81 EINKAYGVFGTTIDLFITLAKSYFFLFVSIITRWSLPRLRMDQLLNLGWKFLLPLSLGN 139