BLASTX nr result
ID: Cheilocostus21_contig00043109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00043109 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406574.1| PREDICTED: WPP domain-associated protein-lik... 115 7e-27 ref|XP_020092945.1| WPP domain-associated protein-like [Ananas c... 107 7e-24 ref|XP_010907331.1| PREDICTED: WPP domain-associated protein-lik... 103 2e-22 ref|XP_008796779.2| PREDICTED: LOW QUALITY PROTEIN: WPP domain-a... 103 2e-22 ref|XP_008794444.1| PREDICTED: WPP domain-associated protein iso... 102 5e-22 ref|XP_010923691.1| PREDICTED: WPP domain-associated protein [El... 102 5e-22 ref|XP_008794443.1| PREDICTED: WPP domain-associated protein iso... 99 5e-21 gb|EMS59807.1| hypothetical protein TRIUR3_14612 [Triticum urartu] 99 7e-21 ref|XP_004963235.1| WPP domain-associated protein [Setaria itali... 99 8e-21 ref|XP_002443545.1| WPP domain-associated protein isoform X2 [So... 99 8e-21 ref|XP_021302203.1| WPP domain-associated protein isoform X1 [So... 99 8e-21 ref|XP_008794442.1| PREDICTED: WPP domain-associated protein iso... 98 1e-20 ref|XP_020151191.1| WPP domain-associated protein-like [Aegilops... 98 1e-20 gb|OEL27514.1| WPP domain-associated protein [Dichanthelium olig... 97 2e-20 gb|PAN21869.1| hypothetical protein PAHAL_C04731 [Panicum hallii] 97 2e-20 ref|XP_008674304.1| WPP domain-associated protein isoform X2 [Ze... 97 3e-20 ref|XP_006664188.1| PREDICTED: WPP domain-associated protein-lik... 97 3e-20 ref|XP_015618515.1| PREDICTED: WPP domain-associated protein [Or... 97 4e-20 ref|XP_006664187.1| PREDICTED: WPP domain-associated protein-lik... 97 4e-20 gb|EEC69664.1| hypothetical protein OsI_39091 [Oryza sativa Indi... 96 1e-19 >ref|XP_009406574.1| PREDICTED: WPP domain-associated protein-like [Musa acuminata subsp. malaccensis] ref|XP_009406575.1| PREDICTED: WPP domain-associated protein-like [Musa acuminata subsp. malaccensis] ref|XP_009406576.1| PREDICTED: WPP domain-associated protein-like [Musa acuminata subsp. malaccensis] Length = 745 Score = 115 bits (289), Expect = 7e-27 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKKC WYKNMLD+RCSDL+KAEAEVDLL DEVE L+GLLGKIY+ALDHYSPVLQHYPG+ Sbjct: 667 KKKCFWYKNMLDVRCSDLQKAEAEVDLLGDEVEALVGLLGKIYLALDHYSPVLQHYPGV 725 >ref|XP_020092945.1| WPP domain-associated protein-like [Ananas comosus] Length = 863 Score = 107 bits (267), Expect = 7e-24 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK LWYK ML+IRCSDL+KAEAEVDLL DEV++L+ LLGKIY+ALDHYSPVLQHYPG+ Sbjct: 786 KKKVLWYKQMLEIRCSDLQKAEAEVDLLGDEVDSLLSLLGKIYIALDHYSPVLQHYPGV 844 >ref|XP_010907331.1| PREDICTED: WPP domain-associated protein-like [Elaeis guineensis] Length = 877 Score = 103 bits (257), Expect = 2e-22 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+IRCS+L+KAEAEVDLL DEV+ L+GLLGKIYVALDHYSPVLQHYPG+ Sbjct: 803 KKKEFWYKQILEIRCSNLQKAEAEVDLLGDEVDALLGLLGKIYVALDHYSPVLQHYPGV 861 >ref|XP_008796779.2| PREDICTED: LOW QUALITY PROTEIN: WPP domain-associated protein-like [Phoenix dactylifera] Length = 877 Score = 103 bits (256), Expect = 2e-22 Identities = 47/58 (81%), Positives = 53/58 (91%) Frame = +1 Query: 4 KKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KK WYK ML+IRCS+L+KAEAEVDLL DEV+ L+GLLGKIYVALDHYSPVLQHYPG+ Sbjct: 804 KKEFWYKQMLEIRCSNLQKAEAEVDLLGDEVDALLGLLGKIYVALDHYSPVLQHYPGV 861 >ref|XP_008794444.1| PREDICTED: WPP domain-associated protein isoform X3 [Phoenix dactylifera] Length = 868 Score = 102 bits (253), Expect = 5e-22 Identities = 46/64 (71%), Positives = 54/64 (84%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGIR 180 +KK W+K ML+IRCS+ +KAEAEVDLL DEV+ L+GLLGKIY+ALDHYSPVLQHYPG R Sbjct: 800 EKKESWFKQMLEIRCSNFQKAEAEVDLLGDEVDALLGLLGKIYIALDHYSPVLQHYPGFR 859 Query: 181 FSAW 192 W Sbjct: 860 QILW 863 >ref|XP_010923691.1| PREDICTED: WPP domain-associated protein [Elaeis guineensis] Length = 877 Score = 102 bits (253), Expect = 5e-22 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK ML+IRCS+L+KAEAEVDLL DEV+ L+GLLGKIY+ALDHYSP+LQHYPG+ Sbjct: 800 EKKESWYKQMLEIRCSNLQKAEAEVDLLGDEVDALLGLLGKIYIALDHYSPILQHYPGV 858 >ref|XP_008794443.1| PREDICTED: WPP domain-associated protein isoform X2 [Phoenix dactylifera] Length = 874 Score = 99.4 bits (246), Expect = 5e-21 Identities = 44/59 (74%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK W+K ML+IRCS+ +KAEAEVDLL DEV+ L+GLLGKIY+ALDHYSPVLQHYPG+ Sbjct: 800 EKKESWFKQMLEIRCSNFQKAEAEVDLLGDEVDALLGLLGKIYIALDHYSPVLQHYPGV 858 >gb|EMS59807.1| hypothetical protein TRIUR3_14612 [Triticum urartu] Length = 516 Score = 98.6 bits (244), Expect = 7e-21 Identities = 43/59 (72%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+I+CS+L KAEAEVD+L DEVETL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 433 KKKEFWYKQILEIKCSNLEKAEAEVDVLGDEVETLLSVLGKIYIALDHYSPVLKHYPGV 491 >ref|XP_004963235.1| WPP domain-associated protein [Setaria italica] gb|KQL17309.1| hypothetical protein SETIT_021599mg [Setaria italica] Length = 576 Score = 98.6 bits (244), Expect = 8e-21 Identities = 42/59 (71%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK +L+I+CS+LRKAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 502 RKKEFWYKQILEIKCSNLRKAEAEVDILGDEVDTLLSVLGKIYIALDHYSPVLKHYPGV 560 >ref|XP_002443545.1| WPP domain-associated protein isoform X2 [Sorghum bicolor] gb|EES17383.1| hypothetical protein SORBI_3008G167700 [Sorghum bicolor] Length = 588 Score = 98.6 bits (244), Expect = 8e-21 Identities = 42/59 (71%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK +L+I+CS+LRKAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 505 RKKEFWYKQILEIKCSNLRKAEAEVDILGDEVDTLLSVLGKIYIALDHYSPVLKHYPGV 563 >ref|XP_021302203.1| WPP domain-associated protein isoform X1 [Sorghum bicolor] Length = 597 Score = 98.6 bits (244), Expect = 8e-21 Identities = 42/59 (71%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK +L+I+CS+LRKAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 514 RKKEFWYKQILEIKCSNLRKAEAEVDILGDEVDTLLSVLGKIYIALDHYSPVLKHYPGV 572 >ref|XP_008794442.1| PREDICTED: WPP domain-associated protein isoform X1 [Phoenix dactylifera] Length = 894 Score = 98.2 bits (243), Expect = 1e-20 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPG 174 +KK W+K ML+IRCS+ +KAEAEVDLL DEV+ L+GLLGKIY+ALDHYSPVLQHYPG Sbjct: 800 EKKESWFKQMLEIRCSNFQKAEAEVDLLGDEVDALLGLLGKIYIALDHYSPVLQHYPG 857 >ref|XP_020151191.1| WPP domain-associated protein-like [Aegilops tauschii subsp. tauschii] Length = 571 Score = 97.8 bits (242), Expect = 1e-20 Identities = 43/59 (72%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+I+CS+L KAEAEVD+L DEVETL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 488 KKKEFWYKQILEIKCSNLEKAEAEVDVLGDEVETLLKVLGKIYIALDHYSPVLKHYPGV 546 >gb|OEL27514.1| WPP domain-associated protein [Dichanthelium oligosanthes] Length = 558 Score = 97.4 bits (241), Expect = 2e-20 Identities = 42/59 (71%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK +++I+CS+LRKAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPGI Sbjct: 484 RKKEFWYKQIVEIKCSNLRKAEAEVDVLGDEVDTLLSVLGKIYIALDHYSPVLKHYPGI 542 >gb|PAN21869.1| hypothetical protein PAHAL_C04731 [Panicum hallii] Length = 576 Score = 97.4 bits (241), Expect = 2e-20 Identities = 41/59 (69%), Positives = 54/59 (91%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 +KK WYK +++I+CS+LRKAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 502 RKKEFWYKQIIEIKCSNLRKAEAEVDVLGDEVDTLLSVLGKIYIALDHYSPVLKHYPGV 560 >ref|XP_008674304.1| WPP domain-associated protein isoform X2 [Zea mays] Length = 563 Score = 97.1 bits (240), Expect = 3e-20 Identities = 42/60 (70%), Positives = 54/60 (90%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGIR 180 +KK WYK +L+I+CS+L KAEAEVD+L DEV+TL+ +LGKIY+ALDHYSPVL+HYPG+R Sbjct: 500 RKKEFWYKQILEIKCSNLWKAEAEVDVLGDEVDTLLSVLGKIYIALDHYSPVLKHYPGVR 559 >ref|XP_006664188.1| PREDICTED: WPP domain-associated protein-like isoform X2 [Oryza brachyantha] Length = 553 Score = 96.7 bits (239), Expect = 3e-20 Identities = 41/59 (69%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+I+CS+L+KAEAEVD+L DEV+ L+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 479 KKKEFWYKQILEIKCSNLQKAEAEVDILGDEVDALLSILGKIYIALDHYSPVLKHYPGV 537 >ref|XP_015618515.1| PREDICTED: WPP domain-associated protein [Oryza sativa Japonica Group] gb|ABA99381.1| WPP domain associated protein, putative, expressed [Oryza sativa Japonica Group] dbj|BAF30276.1| Os12g0612300 [Oryza sativa Japonica Group] gb|EAZ21196.1| hypothetical protein OsJ_36846 [Oryza sativa Japonica Group] dbj|BAT18046.1| Os12g0612300 [Oryza sativa Japonica Group] Length = 579 Score = 96.7 bits (239), Expect = 4e-20 Identities = 41/59 (69%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+I+CS+L+KAEAEVD+L DEV+ L+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 505 KKKEFWYKQILEIKCSNLQKAEAEVDILGDEVDALLSILGKIYIALDHYSPVLKHYPGV 563 >ref|XP_006664187.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Oryza brachyantha] Length = 580 Score = 96.7 bits (239), Expect = 4e-20 Identities = 41/59 (69%), Positives = 53/59 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPGI 177 KKK WYK +L+I+CS+L+KAEAEVD+L DEV+ L+ +LGKIY+ALDHYSPVL+HYPG+ Sbjct: 506 KKKEFWYKQILEIKCSNLQKAEAEVDILGDEVDALLSILGKIYIALDHYSPVLKHYPGV 564 >gb|EEC69664.1| hypothetical protein OsI_39091 [Oryza sativa Indica Group] Length = 918 Score = 95.5 bits (236), Expect = 1e-19 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = +1 Query: 1 KKKCLWYKNMLDIRCSDLRKAEAEVDLLADEVETLIGLLGKIYVALDHYSPVLQHYPG 174 KKK WYK +L+I+CS+L+KAEAEVD+L DEV+ L+ +LGKIY+ALDHYSPVL+HYPG Sbjct: 505 KKKEFWYKQILEIKCSNLQKAEAEVDILGDEVDALLSILGKIYIALDHYSPVLKHYPG 562