BLASTX nr result
ID: Cheilocostus21_contig00042953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042953 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390130.1| PREDICTED: probable LRR receptor-like serine... 56 8e-06 >ref|XP_009390130.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570 [Musa acuminata subsp. malaccensis] Length = 1051 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 448 AVLSIRSFINYDPSKALASWNGSFKLCQWSGVFCNNQS 335 A+LS +SF+ DPSKALASWN S CQW GV C+N+S Sbjct: 47 ALLSFKSFVYDDPSKALASWNSSLHFCQWQGVRCHNRS 84