BLASTX nr result
ID: Cheilocostus21_contig00042919
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042919 (622 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018677976.1| PREDICTED: transcription elongation factor S... 70 3e-10 ref|XP_009380257.1| PREDICTED: transcription elongation factor S... 70 3e-10 ref|XP_009383878.1| PREDICTED: transcription elongation factor S... 68 1e-09 >ref|XP_018677976.1| PREDICTED: transcription elongation factor SPT6-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 1712 Score = 69.7 bits (169), Expect = 3e-10 Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 25/96 (26%) Frame = -3 Query: 578 DSDYGSSQ---GNNDGLGSFPGDKVERSPGRDPWGWSNRHS------------DGDGEWG 444 DSDYGS++ NDGL +FPG KV+ SPGRDPWGW + S +G G+WG Sbjct: 1532 DSDYGSAKWGSNENDGLSTFPGAKVQNSPGRDPWGWGSAGSGGGQGGISTGGGNGGGDWG 1591 Query: 443 RCYADRSGHNR----------ASAGSGVSSLPTGSN 366 YA G ++ + GSG SS TG N Sbjct: 1592 SGYATDRGGDKWGGGGIKGAWSEGGSGGSSWGTGGN 1627 >ref|XP_009380257.1| PREDICTED: transcription elongation factor SPT6-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 1713 Score = 69.7 bits (169), Expect = 3e-10 Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 25/96 (26%) Frame = -3 Query: 578 DSDYGSSQ---GNNDGLGSFPGDKVERSPGRDPWGWSNRHS------------DGDGEWG 444 DSDYGS++ NDGL +FPG KV+ SPGRDPWGW + S +G G+WG Sbjct: 1533 DSDYGSAKWGSNENDGLSTFPGAKVQNSPGRDPWGWGSAGSGGGQGGISTGGGNGGGDWG 1592 Query: 443 RCYADRSGHNR----------ASAGSGVSSLPTGSN 366 YA G ++ + GSG SS TG N Sbjct: 1593 SGYATDRGGDKWGGGGIKGAWSEGGSGGSSWGTGGN 1628 >ref|XP_009383878.1| PREDICTED: transcription elongation factor SPT6-like [Musa acuminata subsp. malaccensis] Length = 1726 Score = 68.2 bits (165), Expect = 1e-09 Identities = 40/96 (41%), Positives = 48/96 (50%), Gaps = 24/96 (25%) Frame = -3 Query: 581 HDSDYGSSQ---GNNDGLGSFPGDKVERSPGRDPWGW------------SNRHSDGDGEW 447 HDS YG+++ N+GL +FPG KV+ SPGRDPWGW + S G G+W Sbjct: 1537 HDSGYGATKWGSNENNGLSTFPGAKVQNSPGRDPWGWGSGGSGGGQGGSNTGGSTGGGDW 1596 Query: 446 GRCYADR---------SGHNRASAGSGVSSLPTGSN 366 G YADR S GSG SS TG N Sbjct: 1597 GSGYADRGSDKWGGGGSKSGWGEGGSGGSSWGTGGN 1632