BLASTX nr result
ID: Cheilocostus21_contig00042439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042439 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY44981.1| hypothetical protein CUMW_085990 [Citrus unshiu] 89 2e-19 ref|XP_019427582.1| PREDICTED: protein phosphatase 2C 32-like [L... 88 3e-19 ref|XP_009384679.1| PREDICTED: protein phosphatase 2C 32-like [M... 95 3e-19 gb|PKI68675.1| hypothetical protein CRG98_010955 [Punica granatum] 88 4e-19 emb|CBI37033.3| unnamed protein product, partial [Vitis vinifera] 89 5e-19 gb|ONI06106.1| hypothetical protein PRUPE_5G040800 [Prunus persica] 86 2e-18 ref|XP_006651427.1| PREDICTED: protein phosphatase 2C 32-like [O... 92 3e-18 gb|PAN49468.1| hypothetical protein PAHAL_B00774 [Panicum hallii... 92 3e-18 ref|XP_009413699.1| PREDICTED: protein phosphatase 2C 32-like [M... 92 3e-18 ref|XP_004984261.1| protein phosphatase 2C 32 [Setaria italica] ... 92 3e-18 ref|XP_015631960.1| PREDICTED: protein phosphatase 2C 32 [Oryza ... 92 3e-18 gb|EAY90195.1| hypothetical protein OsI_11759 [Oryza sativa Indi... 92 3e-18 gb|EEE59122.1| hypothetical protein OsJ_11008 [Oryza sativa Japo... 92 3e-18 gb|KHN42615.1| Protein phosphatase 2C 29 [Glycine soja] 87 4e-18 ref|XP_023910781.1| protein phosphatase 2C 32 [Quercus suber] 91 5e-18 ref|XP_010045495.1| PREDICTED: protein phosphatase 2C 32 [Eucaly... 91 5e-18 gb|PIA40759.1| hypothetical protein AQUCO_02400078v1 [Aquilegia ... 91 5e-18 gb|PIA40760.1| hypothetical protein AQUCO_02400078v1 [Aquilegia ... 91 5e-18 gb|POF12344.1| protein phosphatase 2c 32 [Quercus suber] 91 5e-18 ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Popu... 86 5e-18 >dbj|GAY44981.1| hypothetical protein CUMW_085990 [Citrus unshiu] Length = 148 Score = 89.4 bits (220), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIP GDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 105 RAAKKNGMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSS 147 >ref|XP_019427582.1| PREDICTED: protein phosphatase 2C 32-like [Lupinus angustifolius] Length = 117 Score = 88.2 bits (217), Expect = 3e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIP GDRRKYHDDVSVMV+SLEGRIW+SS Sbjct: 74 RAAKKNGMDFHELLDIPNGDRRKYHDDVSVMVVSLEGRIWKSS 116 >ref|XP_009384679.1| PREDICTED: protein phosphatase 2C 32-like [Musa acuminata subsp. malaccensis] Length = 956 Score = 94.7 bits (234), Expect = 3e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 536 IRAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS 402 IRAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS Sbjct: 912 IRAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS 956 >gb|PKI68675.1| hypothetical protein CRG98_010955 [Punica granatum] Length = 117 Score = 87.8 bits (216), Expect = 4e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAA+KNGMDFHELLDIP GDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 74 RAAEKNGMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSS 116 >emb|CBI37033.3| unnamed protein product, partial [Vitis vinifera] Length = 180 Score = 89.4 bits (220), Expect = 5e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIP GDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 137 RAAKKNGMDFHELLDIPHGDRRKYHDDVSVMVVSLEGRIWRSS 179 >gb|ONI06106.1| hypothetical protein PRUPE_5G040800 [Prunus persica] Length = 120 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKK GMDFHELLDIPQGDRRKYHDDV+VMVISLEGRIW+SS Sbjct: 74 RAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSS 116 >ref|XP_006651427.1| PREDICTED: protein phosphatase 2C 32-like [Oryza brachyantha] Length = 931 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 888 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 930 >gb|PAN49468.1| hypothetical protein PAHAL_B00774 [Panicum hallii] gb|PAN49469.1| hypothetical protein PAHAL_B00774 [Panicum hallii] gb|PAN49470.1| hypothetical protein PAHAL_B00774 [Panicum hallii] gb|PAN49471.1| hypothetical protein PAHAL_B00774 [Panicum hallii] Length = 963 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 920 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 962 >ref|XP_009413699.1| PREDICTED: protein phosphatase 2C 32-like [Musa acuminata subsp. malaccensis] Length = 963 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 536 IRAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS 402 +RAAK NGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS Sbjct: 919 LRAAKTNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSSS 963 >ref|XP_004984261.1| protein phosphatase 2C 32 [Setaria italica] gb|KQK90731.1| hypothetical protein SETIT_034099mg [Setaria italica] Length = 964 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 921 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 963 >ref|XP_015631960.1| PREDICTED: protein phosphatase 2C 32 [Oryza sativa Japonica Group] ref|XP_015631961.1| PREDICTED: protein phosphatase 2C 32 [Oryza sativa Japonica Group] ref|XP_015631962.1| PREDICTED: protein phosphatase 2C 32 [Oryza sativa Japonica Group] ref|XP_015631963.1| PREDICTED: protein phosphatase 2C 32 [Oryza sativa Japonica Group] ref|XP_015631964.1| PREDICTED: protein phosphatase 2C 32 [Oryza sativa Japonica Group] gb|AAO62336.1| putative protein phosphatase [Oryza sativa Japonica Group] gb|ABF96191.1| Protein phosphatase 2C containing protein, expressed [Oryza sativa Japonica Group] gb|ABF96192.1| Protein phosphatase 2C containing protein, expressed [Oryza sativa Japonica Group] dbj|BAF12119.1| Os03g0372500 [Oryza sativa Japonica Group] dbj|BAG95825.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAH00833.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS84373.1| Os03g0372500 [Oryza sativa Japonica Group] Length = 977 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 934 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 976 >gb|EAY90195.1| hypothetical protein OsI_11759 [Oryza sativa Indica Group] Length = 978 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 935 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 977 >gb|EEE59122.1| hypothetical protein OsJ_11008 [Oryza sativa Japonica Group] Length = 1032 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS Sbjct: 989 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 1031 >gb|KHN42615.1| Protein phosphatase 2C 29 [Glycine soja] Length = 170 Score = 86.7 bits (213), Expect = 4e-18 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -1 Query: 536 IRAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 +RAAKK GMDFHELLDIPQGDRRKYHDDV+VMV+SLEGRIW+SS Sbjct: 123 LRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVVSLEGRIWKSS 166 >ref|XP_023910781.1| protein phosphatase 2C 32 [Quercus suber] Length = 898 Score = 91.3 bits (225), Expect = 5e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 855 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVVSLEGRIWRSS 897 >ref|XP_010045495.1| PREDICTED: protein phosphatase 2C 32 [Eucalyptus grandis] gb|KCW88620.1| hypothetical protein EUGRSUZ_A00991 [Eucalyptus grandis] Length = 900 Score = 91.3 bits (225), Expect = 5e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 857 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVVSLEGRIWRSS 899 >gb|PIA40759.1| hypothetical protein AQUCO_02400078v1 [Aquilegia coerulea] Length = 909 Score = 91.3 bits (225), Expect = 5e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 866 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVVSLEGRIWRSS 908 >gb|PIA40760.1| hypothetical protein AQUCO_02400078v1 [Aquilegia coerulea] Length = 909 Score = 91.3 bits (225), Expect = 5e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 866 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVVSLEGRIWRSS 908 >gb|POF12344.1| protein phosphatase 2c 32 [Quercus suber] Length = 911 Score = 91.3 bits (225), Expect = 5e-18 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMV+SLEGRIWRSS Sbjct: 868 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVVSLEGRIWRSS 910 >ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] Length = 169 Score = 86.3 bits (212), Expect = 5e-18 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 533 RAAKKNGMDFHELLDIPQGDRRKYHDDVSVMVISLEGRIWRSS 405 RAAKK GMDFHELLDIPQGDRRKYHDDV+VMVISLEGRIW+SS Sbjct: 123 RAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSS 165