BLASTX nr result
ID: Cheilocostus21_contig00042400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042400 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP70864.1| Fasciclin-like arabinogalactan protein 11 [Cajanu... 73 3e-13 ref|XP_010558264.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 5e-13 ref|XP_024188727.1| fasciclin-like arabinogalactan protein 11 [R... 74 6e-13 gb|PKU78284.1| Fasciclin-like arabinogalactan protein 11 [Dendro... 74 6e-13 ref|XP_020706088.1| fasciclin-like arabinogalactan protein 11 [D... 74 6e-13 ref|XP_020706089.1| fasciclin-like arabinogalactan protein 11 [D... 74 6e-13 ref|XP_018458101.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 7e-13 ref|XP_010424800.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_009130731.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_009125482.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_013613158.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_006398764.1| fasciclin-like arabinogalactan protein 11 [E... 74 8e-13 ref|XP_010490785.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_006286413.1| fasciclin-like arabinogalactan protein 11 [C... 74 8e-13 ref|NP_195937.1| FASCICLIN-like arabinogalactan-protein 11 [Arab... 74 8e-13 ref|XP_020877442.1| fasciclin-like arabinogalactan protein 11 [A... 74 8e-13 gb|AAM62616.1| arabinogalactan protein-like [Arabidopsis thaliana] 74 8e-13 ref|XP_020213325.1| fasciclin-like arabinogalactan protein 11 [C... 74 8e-13 ref|XP_010452179.1| PREDICTED: fasciclin-like arabinogalactan pr... 74 8e-13 ref|XP_013623680.1| PREDICTED: fasciclin-like arabinogalactan pr... 73 1e-12 >gb|KYP70864.1| Fasciclin-like arabinogalactan protein 11 [Cajanus cajan] Length = 152 Score = 72.8 bits (177), Expect = 3e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 459 FPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +PLNVT++GNQVN++TGVV TV NTI S QLAVYQV VLLP A+FGS Sbjct: 37 YPLNVTTSGNQVNVTTGVVDTTVSNTIFSDNQLAVYQVDKVLLPMALFGS 86 >ref|XP_010558264.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Tarenaya hassleriana] Length = 243 Score = 73.9 bits (180), Expect = 5e-13 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV TV NTI S +QL+VYQV VLLP A+FGS Sbjct: 131 KFPLNITSSGNQVNITTGVVQATVANTIYSDKQLSVYQVDQVLLPLALFGS 181 >ref|XP_024188727.1| fasciclin-like arabinogalactan protein 11 [Rosa chinensis] gb|PRQ43524.1| putative FAS1 domain-containing protein [Rosa chinensis] Length = 245 Score = 73.9 bits (180), Expect = 6e-13 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLNVT++GNQVNI+TGVVT +V NTI + QLAVYQV VLLP AIFGS Sbjct: 137 QFPLNVTTSGNQVNITTGVVTASVANTIFTDNQLAVYQVDQVLLPLAIFGS 187 >gb|PKU78284.1| Fasciclin-like arabinogalactan protein 11 [Dendrobium catenatum] Length = 249 Score = 73.9 bits (180), Expect = 6e-13 Identities = 43/73 (58%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS-XXXXXXXX 286 +FPLNVTS GNQVNISTGVV TV N++ S +LAVYQV VLLP AIFGS Sbjct: 136 QFPLNVTSAGNQVNISTGVVNTTVSNSLYSDNKLAVYQVDKVLLPLAIFGSAAPAPAPGP 195 Query: 285 XXXXAEGKPTAAA 247 + KPTAAA Sbjct: 196 ASSKVKKKPTAAA 208 >ref|XP_020706088.1| fasciclin-like arabinogalactan protein 11 [Dendrobium catenatum] gb|PKU78283.1| Fasciclin-like arabinogalactan protein 11 [Dendrobium catenatum] Length = 249 Score = 73.9 bits (180), Expect = 6e-13 Identities = 43/73 (58%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS-XXXXXXXX 286 +FPLNVTS GNQVNISTGVV TV N++ S +LAVYQV VLLP AIFGS Sbjct: 136 QFPLNVTSAGNQVNISTGVVNTTVSNSLYSDSKLAVYQVDRVLLPLAIFGSAAPAPAPGP 195 Query: 285 XXXXAEGKPTAAA 247 + KPTAAA Sbjct: 196 ASSKVKKKPTAAA 208 >ref|XP_020706089.1| fasciclin-like arabinogalactan protein 11 [Dendrobium catenatum] Length = 249 Score = 73.9 bits (180), Expect = 6e-13 Identities = 43/73 (58%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS-XXXXXXXX 286 +FPLNVTS GNQVNISTGVV TV N++ S +LAVYQV VLLP AIFGS Sbjct: 136 QFPLNVTSAGNQVNISTGVVNTTVSNSLYSDSKLAVYQVDRVLLPLAIFGSAAPAPAPGP 195 Query: 285 XXXXAEGKPTAAA 247 + KPTAAA Sbjct: 196 ASSKVKKKPTAAA 208 >ref|XP_018458101.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Raphanus sativus] Length = 242 Score = 73.6 bits (179), Expect = 7e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_010424800.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina sativa] Length = 243 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 138 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 188 >ref|XP_009130731.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica rapa] ref|XP_022566091.1| fasciclin-like arabinogalactan protein 11 [Brassica napus] Length = 243 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_009125482.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica rapa] ref|XP_013720250.1| fasciclin-like arabinogalactan protein 11 [Brassica napus] emb|CDY62902.1| BnaAnng18460D [Brassica napus] Length = 243 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_013613158.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica oleracea var. oleracea] ref|XP_013655657.1| fasciclin-like arabinogalactan protein 11 [Brassica napus] emb|CDY44345.1| BnaC02g03320D [Brassica napus] Length = 243 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_006398764.1| fasciclin-like arabinogalactan protein 11 [Eutrema salsugineum] gb|ESQ40217.1| hypothetical protein EUTSA_v10015384mg [Eutrema salsugineum] Length = 243 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_010490785.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina sativa] Length = 246 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_006286413.1| fasciclin-like arabinogalactan protein 11 [Capsella rubella] gb|EOA19311.1| hypothetical protein CARUB_v10002835mg [Capsella rubella] Length = 246 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|NP_195937.1| FASCICLIN-like arabinogalactan-protein 11 [Arabidopsis thaliana] sp|Q8LEJ6.2|FLA11_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 11; Flags: Precursor gb|AAK25893.1|AF360183_1 putative arabinogalactan protein [Arabidopsis thaliana] emb|CAB86084.1| arabinogalactan protein-like [Arabidopsis thaliana] dbj|BAB08377.1| unnamed protein product [Arabidopsis thaliana] gb|AAK64076.1| putative arabinogalactan protein [Arabidopsis thaliana] gb|AED90563.1| FASCICLIN-like arabinogalactan-protein 11 [Arabidopsis thaliana] gb|OAO94081.1| FLA11 [Arabidopsis thaliana] Length = 246 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_020877442.1| fasciclin-like arabinogalactan protein 11 [Arabidopsis lyrata subsp. lyrata] gb|EFH49336.1| hypothetical protein ARALYDRAFT_487087 [Arabidopsis lyrata subsp. lyrata] Length = 246 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >gb|AAM62616.1| arabinogalactan protein-like [Arabidopsis thaliana] Length = 246 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 187 >ref|XP_020213325.1| fasciclin-like arabinogalactan protein 11 [Cajanus cajan] gb|KYP70866.1| Fasciclin-like arabinogalactan protein 11 [Cajanus cajan] Length = 247 Score = 73.6 bits (179), Expect = 8e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 459 FPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +PLNVT++GNQVN++TGVV TV NTI S QLAVYQV VLLP AIFGS Sbjct: 135 YPLNVTTSGNQVNVTTGVVDTTVSNTIFSDNQLAVYQVDKVLLPMAIFGS 184 >ref|XP_010452179.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina sativa] Length = 247 Score = 73.6 bits (179), Expect = 8e-13 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +QLAVYQV VLLP A+FGS Sbjct: 138 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGS 188 >ref|XP_013623680.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica oleracea var. oleracea] ref|XP_013725007.2| fasciclin-like arabinogalactan protein 11 [Brassica napus] Length = 243 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = -3 Query: 462 RFPLNVTSNGNQVNISTGVVTVTVDNTICSSEQLAVYQVSTVLLPEAIFGS 310 +FPLN+TS+GNQVNI+TGVV+ TV N++ S +Q+AVYQV VLLP A+FGS Sbjct: 137 KFPLNITSSGNQVNITTGVVSATVANSVYSDKQIAVYQVDQVLLPLAMFGS 187