BLASTX nr result
ID: Cheilocostus21_contig00042239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042239 (928 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONM01880.1| Basic leucine zipper 25 [Zea mays] 54 3e-06 gb|ONM01875.1| Basic leucine zipper 25 [Zea mays] 54 4e-06 gb|ONM01874.1| Basic leucine zipper 25 [Zea mays] 54 4e-06 >gb|ONM01880.1| Basic leucine zipper 25 [Zea mays] Length = 68 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 439 MVSNRESARRSRKRKQAHLADLESQVNNIISFDSS 543 MVSNRESARRSRKRKQAHL DLESQV+ + S ++S Sbjct: 1 MVSNRESARRSRKRKQAHLTDLESQVSRLTSENAS 35 >gb|ONM01875.1| Basic leucine zipper 25 [Zea mays] Length = 71 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 439 MVSNRESARRSRKRKQAHLADLESQVNNIISFDSS 543 MVSNRESARRSRKRKQAHL DLESQV+ + S ++S Sbjct: 4 MVSNRESARRSRKRKQAHLTDLESQVSRLTSENAS 38 >gb|ONM01874.1| Basic leucine zipper 25 [Zea mays] Length = 74 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 439 MVSNRESARRSRKRKQAHLADLESQVNNIISFDSS 543 MVSNRESARRSRKRKQAHL DLESQV+ + S ++S Sbjct: 4 MVSNRESARRSRKRKQAHLTDLESQVSRLTSENAS 38