BLASTX nr result
ID: Cheilocostus21_contig00042071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042071 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO37767.1| hypothetical protein CISIN_1g046558mg, partial [C... 54 4e-06 >gb|KDO37767.1| hypothetical protein CISIN_1g046558mg, partial [Citrus sinensis] Length = 136 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/99 (27%), Positives = 52/99 (52%), Gaps = 1/99 (1%) Frame = -1 Query: 545 PPSSGWIKINVDESYKKTTKSAGIGYVIWDHTSHCFIAYAEVVEPI-ETELLAIRSEISY 369 PP GW+K+NVD++ + AG+G V+ +H A + + EL ++ + Sbjct: 17 PPEEGWLKVNVDDAMDRVNYLAGLGAVVKNHKGETVAAAVSTFKSSGDVELSEAKAVLWG 76 Query: 368 VYARSESIGSKVIFETDCRNSIAMLRNECSFIQDSVWTI 252 + A +++ + VI E+D + I ++ N+ S + D+ W I Sbjct: 77 MQAAAKAGATSVILESDSKGVIELINNKRSTLTDTFWVI 115