BLASTX nr result
ID: Cheilocostus21_contig00042014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00042014 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009407366.1| PREDICTED: uncharacterized protein LOC103990... 57 7e-07 >ref|XP_009407366.1| PREDICTED: uncharacterized protein LOC103990064 [Musa acuminata subsp. malaccensis] Length = 553 Score = 57.4 bits (137), Expect = 7e-07 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = -1 Query: 409 SKLVYIGXXXXXXXXXXXXVFWVIYARERRHRKYNKEQFLVQSGGPN--LQEKMP 251 SK VYIG +FWVIYARERRHR YNK QFLV++G P+ LQEK+P Sbjct: 500 SKRVYIGLVMVSGAVMLSLIFWVIYARERRHRTYNK-QFLVETGRPHLPLQEKVP 553