BLASTX nr result
ID: Cheilocostus21_contig00041896
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041896 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT68161.1| hypothetical protein T459_27648 [Capsicum annuum] 77 3e-14 gb|EEF26763.1| conserved hypothetical protein, partial [Ricinus ... 77 3e-14 gb|KRH37800.1| hypothetical protein GLYMA_09G090100, partial [Gl... 76 4e-14 gb|KDP24741.1| hypothetical protein JCGZ_25490 [Jatropha curcas] 74 5e-14 gb|AAV74370.1| PsaB, partial (chloroplast) [Acorus gramineus] 77 6e-14 gb|AUM60463.1| PsaB, partial (chloroplast) [Anacamptis coriophora] 77 9e-14 gb|AUM60465.1| PsaB, partial (chloroplast) [Herminium sp. PE-Tib... 77 1e-13 gb|AHL29714.1| PsaB, partial (chloroplast) [Risleya atropurpurea] 77 1e-13 gb|AUM60425.1| PsaB, partial (chloroplast) [Platanthera superantha] 77 1e-13 gb|AFS35567.1| photosystem I P700 apoprotein A2, partial (plasti... 76 1e-13 gb|AUM60467.1| PsaB, partial (chloroplast) [Herminium sp. PE-Tib... 77 1e-13 gb|AHL29715.1| PsaB, partial (chloroplast) [Risleya atropurpurea] 77 1e-13 gb|EEF24449.1| Photosystem I P700 chlorophyll a apoprotein A2, p... 77 1e-13 gb|AKR81012.1| photosystem I P700 apoprotein A2 (plastid) [Stich... 78 2e-13 gb|PHU21382.1| Photosystem I chlorophyll a apoprotein A2 [Capsic... 77 2e-13 gb|ABF82026.1| PSI P700 apoprotein A2, partial (chloroplast) [So... 77 2e-13 gb|PHT45141.1| Photosystem I chlorophyll a apoprotein A2 [Capsic... 77 2e-13 gb|ABG36120.1| PSI P700 apoprotein A2 (chloroplast) [Nicotiana t... 77 2e-13 gb|PHT98753.1| Photosystem I chlorophyll a apoprotein A2 [Capsic... 77 2e-13 gb|AHI62760.1| photosystem I P700 chlorophyll A apoprotein, part... 77 3e-13 >gb|PHT68161.1| hypothetical protein T459_27648 [Capsicum annuum] Length = 199 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 75 >gb|EEF26763.1| conserved hypothetical protein, partial [Ricinus communis] Length = 207 Score = 77.0 bits (188), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 75 >gb|KRH37800.1| hypothetical protein GLYMA_09G090100, partial [Glycine max] Length = 185 Score = 76.3 bits (186), Expect = 4e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNS++FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 62 YDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 103 >gb|KDP24741.1| hypothetical protein JCGZ_25490 [Jatropha curcas] Length = 123 Score = 74.3 bits (181), Expect = 5e-14 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LG I SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGGITSLVAQHMYSLPAYAFIAQD 75 >gb|AAV74370.1| PsaB, partial (chloroplast) [Acorus gramineus] Length = 246 Score = 77.0 bits (188), Expect = 6e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 194 YDTINNSLHFQLGLALACLGVITSLVAQHMYSLPAYAFIAQD 235 >gb|AUM60463.1| PsaB, partial (chloroplast) [Anacamptis coriophora] Length = 273 Score = 77.0 bits (188), Expect = 9e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 75 >gb|AUM60465.1| PsaB, partial (chloroplast) [Herminium sp. PE-Tibet Team 4397] Length = 286 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 75 >gb|AHL29714.1| PsaB, partial (chloroplast) [Risleya atropurpurea] Length = 294 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 40 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 81 >gb|AUM60425.1| PsaB, partial (chloroplast) [Platanthera superantha] Length = 295 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 43 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 84 >gb|AFS35567.1| photosystem I P700 apoprotein A2, partial (plastid) [Fragaria pentaphylla] Length = 244 Score = 76.3 bits (186), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNS++FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 73 YDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 114 >gb|AUM60467.1| PsaB, partial (chloroplast) [Herminium sp. PE-Tibet Team 2518] Length = 297 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 45 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 86 >gb|AHL29715.1| PsaB, partial (chloroplast) [Risleya atropurpurea] Length = 300 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 46 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 87 >gb|EEF24449.1| Photosystem I P700 chlorophyll a apoprotein A2, putative, partial [Ricinus communis] Length = 314 Score = 77.0 bits (188), Expect = 1e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 34 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 75 >gb|AKR81012.1| photosystem I P700 apoprotein A2 (plastid) [Stichoneuron caudatum] Length = 734 Score = 77.8 bits (190), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 323 YDTINNSLHFQLGLALASLGVITSLVAQHVYSLPAYAFIAQD 364 >gb|PHU21382.1| Photosystem I chlorophyll a apoprotein A2 [Capsicum chinense] Length = 364 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 302 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 343 >gb|ABF82026.1| PSI P700 apoprotein A2, partial (chloroplast) [Solanum lycopersicum] Length = 422 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 11 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 52 >gb|PHT45141.1| Photosystem I chlorophyll a apoprotein A2 [Capsicum baccatum] Length = 434 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 23 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 64 >gb|ABG36120.1| PSI P700 apoprotein A2 (chloroplast) [Nicotiana tabacum] Length = 434 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 23 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 64 >gb|PHT98753.1| Photosystem I chlorophyll a apoprotein A2 [Capsicum chinense] Length = 444 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 251 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 292 >gb|AHI62760.1| photosystem I P700 chlorophyll A apoprotein, partial (plastid) [Vanilla griffithii] gb|AHI62761.1| photosystem I P700 chlorophyll A apoprotein, partial (plastid) [Vanilla griffithii] Length = 459 Score = 77.0 bits (188), Expect = 3e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 380 YDTINNSLYFQLGLALAFLGVIISLVAQHIYSLPAYAFIAQD 505 YDTINNSL+FQLGLALA LGVI SLVAQH+YSLPAYAFIAQD Sbjct: 239 YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQD 280