BLASTX nr result
ID: Cheilocostus21_contig00041695
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041695 (832 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251466.1| dihydrofolate synthetase isoform X2 [Asparag... 61 9e-07 ref|XP_009421246.2| PREDICTED: dihydrofolate synthetase [Musa ac... 61 9e-07 ref|XP_020251464.1| dihydrofolate synthetase isoform X1 [Asparag... 61 9e-07 >ref|XP_020251466.1| dihydrofolate synthetase isoform X2 [Asparagus officinalis] Length = 565 Score = 60.8 bits (146), Expect = 9e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 830 SLRTFISLPNLKLQLLGAHQLQNAVTATCTALVLRDQGFLFS 705 +L F+ LP++KL++LG HQLQNAVTATCTAL LR+QGF S Sbjct: 314 NLEMFVDLPDVKLRMLGNHQLQNAVTATCTALCLRNQGFKIS 355 >ref|XP_009421246.2| PREDICTED: dihydrofolate synthetase [Musa acuminata subsp. malaccensis] Length = 576 Score = 60.8 bits (146), Expect = 9e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 827 LRTFISLPNLKLQLLGAHQLQNAVTATCTALVLRDQGFLFS 705 L+ FI++PN+ L LLGAHQLQNA TATCTAL L DQG++ S Sbjct: 333 LQMFITVPNVNLHLLGAHQLQNAATATCTALCLHDQGWVIS 373 >ref|XP_020251464.1| dihydrofolate synthetase isoform X1 [Asparagus officinalis] ref|XP_020251465.1| dihydrofolate synthetase isoform X1 [Asparagus officinalis] Length = 580 Score = 60.8 bits (146), Expect = 9e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 830 SLRTFISLPNLKLQLLGAHQLQNAVTATCTALVLRDQGFLFS 705 +L F+ LP++KL++LG HQLQNAVTATCTAL LR+QGF S Sbjct: 329 NLEMFVDLPDVKLRMLGNHQLQNAVTATCTALCLRNQGFKIS 370