BLASTX nr result
ID: Cheilocostus21_contig00041606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041606 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA60010.1| putative membrane protein [Apostasia shenzhenica] 55 2e-06 ref|XP_009401785.1| PREDICTED: uncharacterized membrane protein ... 56 3e-06 >gb|PKA60010.1| putative membrane protein [Apostasia shenzhenica] Length = 213 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +2 Query: 338 FIWNVVAYRRSLAIHLFLDRFPHTDLLTTNDGQLVK 445 F+WN +++RR++AI LF+DRFP +DLLT +DGQLVK Sbjct: 64 FLWNSLSFRRNIAIFLFVDRFPASDLLTASDGQLVK 99 >ref|XP_009401785.1| PREDICTED: uncharacterized membrane protein At1g16860-like [Musa acuminata subsp. malaccensis] ref|XP_018681238.1| PREDICTED: uncharacterized membrane protein At1g16860-like [Musa acuminata subsp. malaccensis] ref|XP_018681239.1| PREDICTED: uncharacterized membrane protein At1g16860-like [Musa acuminata subsp. malaccensis] Length = 289 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +2 Query: 338 FIWNVVAYRRSLAIHLFLDRFPHTDLLTTNDGQLVK 445 F+WN AYRR L++ LFLDRFP TDLL+ D QLVK Sbjct: 65 FLWNAAAYRRKLSLDLFLDRFPDTDLLSAKDSQLVK 100