BLASTX nr result
ID: Cheilocostus21_contig00041498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041498 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023888138.1| tryptophan--tRNA ligase, chloroplastic/mitoc... 63 3e-09 ref|XP_019197116.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 65 1e-08 ref|XP_019171126.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 65 2e-08 ref|XP_019184951.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 65 2e-08 ref|XP_020266812.1| tryptophan--tRNA ligase, chloroplastic/mitoc... 62 2e-08 emb|CDY35330.1| BnaA04g15170D [Brassica napus] 63 2e-08 gb|KKT95083.1| tryptophanyl-tRNA synthetase, tryptophanyl-tRNA s... 59 3e-08 ref|XP_015884784.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 64 3e-08 ref|XP_007137246.1| hypothetical protein PHAVU_009G1117001g, par... 62 3e-08 ref|XP_021851848.1| tryptophan--tRNA ligase, chloroplastic/mitoc... 64 5e-08 ref|XP_016677921.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 63 7e-08 ref|XP_023891372.1| tryptophan--tRNA ligase, chloroplastic/mitoc... 63 7e-08 gb|POE61949.1| tryptophan--trna ligase, chloroplastic/mitochondr... 63 7e-08 gb|POE61948.1| tryptophan--trna ligase, chloroplastic/mitochondr... 63 7e-08 ref|XP_014498431.1| tryptophan--tRNA ligase, chloroplastic/mitoc... 63 7e-08 ref|XP_018832053.1| PREDICTED: tryptophan--tRNA ligase, chloropl... 62 7e-08 ref|XP_010677409.2| PREDICTED: tryptophan--tRNA ligase, chloropl... 63 7e-08 dbj|GAV65518.1| tRNA-synt_1b domain-containing protein [Cephalot... 63 7e-08 ref|WP_071191755.1| hypothetical protein [Trichormus sp. NMC-1] 58 8e-08 gb|KRH52791.1| hypothetical protein GLYMA_06G088000 [Glycine max] 62 8e-08 >ref|XP_023888138.1| tryptophan--tRNA ligase, chloroplastic/mitochondrial-like, partial [Quercus suber] Length = 114 Score = 63.2 bits (152), Expect = 3e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 67 PTTVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 100 >ref|XP_019197116.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Ipomoea nil] ref|XP_019197117.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Ipomoea nil] ref|XP_019197118.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Ipomoea nil] Length = 399 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 605 FSLNPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 F P KKR+VSGVQPTGS+HLGNYLGAIKNW+QLQ Sbjct: 49 FENPPTSIKKRIVSGVQPTGSIHLGNYLGAIKNWIQLQ 86 >ref|XP_019171126.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Ipomoea nil] Length = 402 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 605 FSLNPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 F P KKR+VSGVQPTGS+HLGNYLGAIKNW+QLQ Sbjct: 52 FENPPTSVKKRIVSGVQPTGSIHLGNYLGAIKNWIQLQ 89 >ref|XP_019184951.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Ipomoea nil] Length = 402 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+QLQ Sbjct: 56 PTSVKKRIVSGVQPTGSIHLGNYLGAIKNWIQLQ 89 >ref|XP_020266812.1| tryptophan--tRNA ligase, chloroplastic/mitochondrial-like [Asparagus officinalis] Length = 156 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 629 KKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 KKRVVSGVQPTGS+HLGNYLGAIKNWV LQ Sbjct: 80 KKRVVSGVQPTGSVHLGNYLGAIKNWVSLQ 109 >emb|CDY35330.1| BnaA04g15170D [Brassica napus] Length = 216 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 590 CADNYFSLNPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 C+D +P + +KRVVSGVQPTGS+HLGNYLGAIKNWV LQ Sbjct: 46 CSDQ---TSPSVSRKRVVSGVQPTGSIHLGNYLGAIKNWVALQ 85 >gb|KKT95083.1| tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, partial [Parcubacteria group bacterium GW2011_GWC1_45_14] Length = 53 Score = 58.9 bits (141), Expect = 3e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 623 LFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 + KKR+ SGVQP+G+LH+GNYLGAIKNWV+LQ Sbjct: 1 MMKKRIFSGVQPSGNLHIGNYLGAIKNWVELQ 32 >ref|XP_015884784.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial [Ziziphus jujuba] Length = 409 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 608 SLNPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 SL +++KR+VSGVQPTGS+HLGNYLGAIKNWV LQ Sbjct: 61 SLKSSIYRKRIVSGVQPTGSVHLGNYLGAIKNWVSLQ 97 >ref|XP_007137246.1| hypothetical protein PHAVU_009G1117001g, partial [Phaseolus vulgaris] gb|ESW09240.1| hypothetical protein PHAVU_009G1117001g, partial [Phaseolus vulgaris] Length = 163 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKRVVSGVQPTGS+HLGNY GAIKNWV LQ Sbjct: 45 PTSVKKRVVSGVQPTGSIHLGNYFGAIKNWVALQ 78 >ref|XP_021851848.1| tryptophan--tRNA ligase, chloroplastic/mitochondrial [Spinacia oleracea] gb|KNA23045.1| hypothetical protein SOVF_028600 [Spinacia oleracea] Length = 407 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 614 NPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 +P L KKRVVSGVQPTG+LHLGNYLGAIKNW LQ Sbjct: 61 SPPLVKKRVVSGVQPTGALHLGNYLGAIKNWTSLQ 95 >ref|XP_016677921.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like isoform X4 [Gossypium hirsutum] Length = 369 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 620 LLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 LLF+KR+VSGVQPTG++HLGNYLGAIK W++LQ Sbjct: 25 LLFRKRIVSGVQPTGAIHLGNYLGAIKTWIELQ 57 >ref|XP_023891372.1| tryptophan--tRNA ligase, chloroplastic/mitochondrial [Quercus suber] Length = 370 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 67 PTTVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 100 >gb|POE61949.1| tryptophan--trna ligase, chloroplastic/mitochondrial [Quercus suber] Length = 377 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 74 PTTVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 107 >gb|POE61948.1| tryptophan--trna ligase, chloroplastic/mitochondrial [Quercus suber] Length = 388 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 74 PTTVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 107 >ref|XP_014498431.1| tryptophan--tRNA ligase, chloroplastic/mitochondrial [Vigna radiata var. radiata] Length = 392 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P+ KKRVVSGVQPTGS+HLGNY GAIKNWV LQ Sbjct: 46 PITVKKRVVSGVQPTGSIHLGNYFGAIKNWVALQ 79 >ref|XP_018832053.1| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial-like isoform X3 [Juglans regia] Length = 263 Score = 62.4 bits (150), Expect = 7e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 71 PSSVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 104 >ref|XP_010677409.2| PREDICTED: tryptophan--tRNA ligase, chloroplastic/mitochondrial [Beta vulgaris subsp. vulgaris] gb|KMT11402.1| hypothetical protein BVRB_5g107300 [Beta vulgaris subsp. vulgaris] Length = 406 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 614 NPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 +P KKRVVSGVQPTG+LHLGNYLGAIKNW+ LQ Sbjct: 58 SPSTVKKRVVSGVQPTGALHLGNYLGAIKNWISLQ 92 >dbj|GAV65518.1| tRNA-synt_1b domain-containing protein [Cephalotus follicularis] Length = 414 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 614 NPLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 +P KKR+VSGVQPTGS+HLGNYLGAIKNW+ LQ Sbjct: 68 SPSTVKKRIVSGVQPTGSIHLGNYLGAIKNWISLQ 102 >ref|WP_071191755.1| hypothetical protein [Trichormus sp. NMC-1] Length = 67 Score = 58.2 bits (139), Expect = 8e-08 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +2 Query: 629 KKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 K+RV+SGVQPTG+LHLGNYLGAI+NWV++Q Sbjct: 3 KQRVLSGVQPTGNLHLGNYLGAIRNWVEIQ 32 >gb|KRH52791.1| hypothetical protein GLYMA_06G088000 [Glycine max] Length = 280 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 617 PLLFKKRVVSGVQPTGSLHLGNYLGAIKNWVQLQ 718 P KKRVVSGVQPTGS+HLGNY GAIKNWV LQ Sbjct: 47 PTFVKKRVVSGVQPTGSIHLGNYFGAIKNWVALQ 80