BLASTX nr result
ID: Cheilocostus21_contig00041215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041215 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009410520.1| PREDICTED: probable potassium transporter 9 ... 137 1e-34 ref|XP_022146796.1| potassium transporter 2 [Momordica charantia] 135 4e-34 gb|ONK62664.1| uncharacterized protein A4U43_C07F6580 [Asparagus... 134 9e-34 ref|XP_023544653.1| potassium transporter 2 [Cucurbita pepo subs... 134 1e-33 ref|XP_022866548.1| potassium transporter 2-like [Olea europaea ... 134 1e-33 gb|AHL20269.1| K+ transporter [Olea europaea] 134 1e-33 ref|XP_008798576.1| PREDICTED: putative potassium transporter 8 ... 134 2e-33 gb|KHG29422.1| Potassium transporter 2 -like protein [Gossypium ... 128 2e-33 gb|ADQ44916.1| potassium uptake transporter 2, partial [Zygophyl... 124 2e-33 ref|XP_007137625.1| hypothetical protein PHAVU_009G1424001g, par... 131 2e-33 ref|XP_020275247.1| putative potassium transporter 8 [Asparagus ... 134 2e-33 ref|XP_022986621.1| potassium transporter 2 [Cucurbita maxima] >... 134 2e-33 ref|XP_022942802.1| potassium transporter 2 [Cucurbita moschata]... 134 2e-33 ref|XP_017615321.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 ref|XP_016754016.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 ref|XP_016718997.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 ref|XP_017615315.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 ref|XP_016754010.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 ref|XP_016718988.1| PREDICTED: potassium transporter 2-like isof... 134 2e-33 gb|PPR90682.1| hypothetical protein GOBAR_AA29996 [Gossypium bar... 134 2e-33 >ref|XP_009410520.1| PREDICTED: probable potassium transporter 9 [Musa acuminata subsp. malaccensis] ref|XP_009410521.1| PREDICTED: probable potassium transporter 9 [Musa acuminata subsp. malaccensis] Length = 771 Score = 137 bits (345), Expect = 1e-34 Identities = 62/72 (86%), Positives = 66/72 (91%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LGIYNI+KWNP IY LSPYYML FL+KTRKAGWMSLGGILLCMTGSEAMF Sbjct: 225 VTWLLCISGLGIYNIVKWNPLIYQALSPYYMLKFLRKTRKAGWMSLGGILLCMTGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSYRA+Q Sbjct: 285 ADLGHFSYRAIQ 296 >ref|XP_022146796.1| potassium transporter 2 [Momordica charantia] Length = 790 Score = 135 bits (341), Expect = 4e-34 Identities = 59/72 (81%), Positives = 66/72 (91%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CISTLGIYNII+WNPH+Y LSPYYM FL+KTRK+GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISTLGIYNIIRWNPHVYQALSPYYMFKFLEKTRKSGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >gb|ONK62664.1| uncharacterized protein A4U43_C07F6580 [Asparagus officinalis] Length = 560 Score = 134 bits (336), Expect = 9e-34 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 224 LTWLLCISALGIYNIIHWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYTAIQ 295 >ref|XP_023544653.1| potassium transporter 2 [Cucurbita pepo subsp. pepo] Length = 791 Score = 134 bits (338), Expect = 1e-33 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CISTLGIYNII WNPH+Y LSPYYM FL+KTRK+GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISTLGIYNIIHWNPHVYRALSPYYMFKFLEKTRKSGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >ref|XP_022866548.1| potassium transporter 2-like [Olea europaea var. sylvestris] ref|XP_022866599.1| potassium transporter 2-like [Olea europaea var. sylvestris] ref|XP_022866666.1| potassium transporter 2-like [Olea europaea var. sylvestris] ref|XP_022866726.1| potassium transporter 2-like [Olea europaea var. sylvestris] ref|XP_022866774.1| potassium transporter 2-like [Olea europaea var. sylvestris] Length = 794 Score = 134 bits (338), Expect = 1e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LG+YNII WNPH+Y LSPYYML FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLICISALGLYNIIHWNPHVYQALSPYYMLRFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >gb|AHL20269.1| K+ transporter [Olea europaea] Length = 794 Score = 134 bits (338), Expect = 1e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LG+YNII WNPH+Y LSPYYML FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLICISALGLYNIIHWNPHVYQALSPYYMLRFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >ref|XP_008798576.1| PREDICTED: putative potassium transporter 8 [Phoenix dactylifera] ref|XP_008798577.1| PREDICTED: putative potassium transporter 8 [Phoenix dactylifera] Length = 773 Score = 134 bits (337), Expect = 2e-33 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LGIYNII+WNPHIY LSPYYM FLK+TRKAGWMSLGG+LLCMTGSEAMF Sbjct: 225 LTWLVCISALGIYNIIQWNPHIYEALSPYYMFKFLKETRKAGWMSLGGVLLCMTGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY ++Q Sbjct: 285 ADLGHFSYTSIQ 296 >gb|KHG29422.1| Potassium transporter 2 -like protein [Gossypium arboreum] Length = 292 Score = 128 bits (322), Expect = 2e-33 Identities = 55/73 (75%), Positives = 63/73 (86%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LG+YN+I WNPH+Y LSPYYM FLKKT+K GWMSLGGILLC+TGSEAMF Sbjct: 69 LTWLLCISALGLYNMIHWNPHVYQALSPYYMFKFLKKTKKGGWMSLGGILLCITGSEAMF 128 Query: 274 ADLGHFSYRAVQE 236 A LGHFSY A+Q+ Sbjct: 129 AKLGHFSYAAIQK 141 >gb|ADQ44916.1| potassium uptake transporter 2, partial [Zygophyllum xanthoxylon] Length = 135 Score = 124 bits (310), Expect = 2e-33 Identities = 52/67 (77%), Positives = 59/67 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS +G+YNI+ WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 68 VTWLLCISAIGVYNIVHWNPHVYQALSPYYMYKFLKKTRKRGWMSLGGILLCITGSEAMF 127 Query: 274 ADLGHFS 254 ADLGHF+ Sbjct: 128 ADLGHFN 134 >ref|XP_007137625.1| hypothetical protein PHAVU_009G1424001g, partial [Phaseolus vulgaris] ref|XP_007137626.1| hypothetical protein PHAVU_009G1424001g, partial [Phaseolus vulgaris] gb|ESW09619.1| hypothetical protein PHAVU_009G1424001g, partial [Phaseolus vulgaris] gb|ESW09620.1| hypothetical protein PHAVU_009G1424001g, partial [Phaseolus vulgaris] Length = 419 Score = 131 bits (329), Expect = 2e-33 Identities = 57/72 (79%), Positives = 63/72 (87%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 + WL CISTLG+YNI KWNPH+Y LSPYYM FLKKTR +GWMSLGGILLC+TGSEAMF Sbjct: 224 LAWLLCISTLGLYNIFKWNPHVYKALSPYYMFKFLKKTRISGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYMAIQ 295 >ref|XP_020275247.1| putative potassium transporter 8 [Asparagus officinalis] ref|XP_020275248.1| putative potassium transporter 8 [Asparagus officinalis] ref|XP_020275249.1| putative potassium transporter 8 [Asparagus officinalis] ref|XP_020275250.1| putative potassium transporter 8 [Asparagus officinalis] ref|XP_020275251.1| putative potassium transporter 8 [Asparagus officinalis] ref|XP_020275252.1| putative potassium transporter 8 [Asparagus officinalis] Length = 742 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 224 LTWLLCISALGIYNIIHWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYTAIQ 295 >ref|XP_022986621.1| potassium transporter 2 [Cucurbita maxima] ref|XP_022986628.1| potassium transporter 2 [Cucurbita maxima] ref|XP_022986636.1| potassium transporter 2 [Cucurbita maxima] Length = 791 Score = 134 bits (336), Expect = 2e-33 Identities = 58/72 (80%), Positives = 65/72 (90%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CISTLG+YNII WNPH+Y LSPYYM FL+KTRK+GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISTLGLYNIIHWNPHVYRALSPYYMFKFLEKTRKSGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >ref|XP_022942802.1| potassium transporter 2 [Cucurbita moschata] ref|XP_022942803.1| potassium transporter 2 [Cucurbita moschata] ref|XP_022942804.1| potassium transporter 2 [Cucurbita moschata] ref|XP_022942805.1| potassium transporter 2 [Cucurbita moschata] ref|XP_022942806.1| potassium transporter 2 [Cucurbita moschata] ref|XP_022942807.1| potassium transporter 2 [Cucurbita moschata] Length = 791 Score = 134 bits (336), Expect = 2e-33 Identities = 58/72 (80%), Positives = 65/72 (90%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CISTLG+YNII WNPH+Y LSPYYM FL+KTRK+GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISTLGLYNIIHWNPHVYRALSPYYMFKFLEKTRKSGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYTAIQ 296 >ref|XP_017615321.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium arboreum] ref|XP_017615322.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium arboreum] ref|XP_017615323.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium arboreum] Length = 791 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 224 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYSAIQ 295 >ref|XP_016754016.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016754017.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016754018.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016754019.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016754020.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016754021.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] Length = 791 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 224 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYSAIQ 295 >ref|XP_016718997.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016718998.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016718999.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] ref|XP_016719000.1| PREDICTED: potassium transporter 2-like isoform X2 [Gossypium hirsutum] Length = 791 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 224 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 283 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 284 ADLGHFSYSAIQ 295 >ref|XP_017615315.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] ref|XP_017615316.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] ref|XP_017615317.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] ref|XP_017615318.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] ref|XP_017615319.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] ref|XP_017615320.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium arboreum] Length = 792 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYSAIQ 296 >ref|XP_016754010.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016754011.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016754012.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016754013.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016754014.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016754015.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] Length = 792 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYSAIQ 296 >ref|XP_016718988.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718989.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718990.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718992.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718993.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718994.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718995.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] ref|XP_016718996.1| PREDICTED: potassium transporter 2-like isoform X1 [Gossypium hirsutum] Length = 792 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYSAIQ 296 >gb|PPR90682.1| hypothetical protein GOBAR_AA29996 [Gossypium barbadense] Length = 829 Score = 134 bits (336), Expect = 2e-33 Identities = 59/72 (81%), Positives = 64/72 (88%) Frame = -1 Query: 454 ITWLFCISTLGIYNIIKWNPHIYLKLSPYYMLNFLKKTRKAGWMSLGGILLCMTGSEAMF 275 +TWL CIS+LGIYNII WNPH+Y LSPYYM FLKKTRK GWMSLGGILLC+TGSEAMF Sbjct: 225 LTWLLCISSLGIYNIIYWNPHVYQALSPYYMFKFLKKTRKGGWMSLGGILLCITGSEAMF 284 Query: 274 ADLGHFSYRAVQ 239 ADLGHFSY A+Q Sbjct: 285 ADLGHFSYSAIQ 296