BLASTX nr result
ID: Cheilocostus21_contig00041200
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041200 (698 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022895254.1| uncharacterized protein LOC111409434 [Olea e... 58 2e-07 ref|XP_022895331.1| uncharacterized protein LOC111409520 [Olea e... 57 7e-06 >ref|XP_022895254.1| uncharacterized protein LOC111409434 [Olea europaea var. sylvestris] Length = 830 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +2 Query: 29 PSYDHL*VFGCLCFTSTHFQRCTKFTPIASRCVYLSY 139 P+YDHL VFGCLCF STH R TKF A+RC++L Y Sbjct: 574 PTYDHLRVFGCLCFASTHHHRLTKFDARATRCLFLGY 610 Score = 25.8 bits (55), Expect(2) = 2e-07 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 130 PKLQKGYWVLDLSIDQIFVSHE 195 P QKGY V DLS + FVS + Sbjct: 611 PYAQKGYKVYDLSAGRTFVSRD 632 >ref|XP_022895331.1| uncharacterized protein LOC111409520 [Olea europaea var. sylvestris] Length = 761 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = +2 Query: 2 QLKCLHKCPPSYDHL*VFGCLCFTSTHFQRCTKFTPIASRCVYLSY 139 Q L + PP+YDHL FGCLCF ST TKF+P ASRC+++ Y Sbjct: 303 QSNMLFQKPPAYDHLKTFGCLCFASTLSNHRTKFSPRASRCIFVGY 348