BLASTX nr result
ID: Cheilocostus21_contig00041141
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00041141 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383053.1| PREDICTED: transcription repressor OFP13-lik... 93 3e-20 ref|XP_010933951.1| PREDICTED: transcription repressor OFP13-lik... 84 3e-16 ref|XP_010919418.1| PREDICTED: transcription repressor OFP13 [El... 82 5e-16 ref|XP_010933952.1| PREDICTED: transcription repressor OFP13-lik... 81 1e-15 ref|XP_009389776.1| PREDICTED: transcription repressor OFP13-lik... 78 8e-15 ref|XP_017700635.1| PREDICTED: transcription repressor OFP13-lik... 78 2e-14 ref|XP_020084001.1| transcription repressor OFP13-like [Ananas c... 77 2e-14 ref|XP_020685693.1| transcription repressor OFP13-like [Dendrobi... 74 4e-13 ref|XP_020585245.1| transcription repressor OFP13-like [Phalaeno... 72 2e-12 ref|XP_020571327.1| nucleolar complex protein 3 homolog isoform ... 72 1e-11 ref|XP_020571325.1| nucleolar complex protein 3 homolog isoform ... 72 1e-11 ref|XP_009391617.1| PREDICTED: transcription repressor OFP13-lik... 70 1e-11 ref|XP_006854716.1| transcription repressor OFP13 [Amborella tri... 65 6e-10 ref|XP_020242992.1| transcription repressor OFP13-like [Asparagu... 64 8e-10 ref|XP_012828687.1| PREDICTED: transcription repressor OFP15-lik... 65 2e-09 ref|XP_011094255.1| transcription repressor OFP13-like [Sesamum ... 65 2e-09 ref|XP_006849249.1| transcription repressor OFP13 [Amborella tri... 64 3e-09 gb|EPS72109.1| hypothetical protein M569_02648, partial [Genlise... 61 4e-09 gb|PKA60440.1| hypothetical protein AXF42_Ash008500 [Apostasia s... 62 7e-09 ref|XP_022855066.1| transcription repressor OFP15-like [Olea eur... 63 8e-09 >ref|XP_009383053.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata subsp. malaccensis] Length = 248 Score = 93.2 bits (230), Expect = 3e-20 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKE 320 EEMV AHELR+WHCL+ELLHCY+RLNEKKHH++IVLAF DL MQL++ DKE Sbjct: 180 EEMVVAHELRDWHCLQELLHCYVRLNEKKHHKMIVLAFADLLMQLMSGDKE 230 >ref|XP_010933951.1| PREDICTED: transcription repressor OFP13-like isoform X1 [Elaeis guineensis] Length = 307 Score = 83.6 bits (205), Expect = 3e-16 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKEEHGRG 305 EMV AH+LREW L+ELLHCYLRLNE+K H +IVLAFVDL M LV++DKE G G Sbjct: 185 EMVEAHQLREWPRLQELLHCYLRLNEEKTHEIIVLAFVDLLMHLVSKDKEGEGLG 239 >ref|XP_010919418.1| PREDICTED: transcription repressor OFP13 [Elaeis guineensis] Length = 244 Score = 82.0 bits (201), Expect = 5e-16 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKE 320 EEMV A++LREW L+ELLHCYLRLNEKK+H++IV+AFVDL M LV++DK+ Sbjct: 181 EEMVEAYQLREWPSLQELLHCYLRLNEKKNHKIIVMAFVDLLMHLVSQDKQ 231 >ref|XP_010933952.1| PREDICTED: transcription repressor OFP13-like isoform X2 [Elaeis guineensis] Length = 242 Score = 81.3 bits (199), Expect = 1e-15 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKEEHGR 308 EMV AH+LREW L+ELLHCYLRLNE+K H +IVLAFVDL M LV++DKE + R Sbjct: 185 EMVEAHQLREWPRLQELLHCYLRLNEEKTHEIIVLAFVDLLMHLVSKDKEVNER 238 >ref|XP_009389776.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata subsp. malaccensis] Length = 204 Score = 78.2 bits (191), Expect = 8e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLV 335 EEMVAAH LREWH L+ELL CYLRLNEKK+H+VIV+AFVDL M ++ Sbjct: 145 EEMVAAHGLREWHSLQELLQCYLRLNEKKNHKVIVMAFVDLLMHIM 190 >ref|XP_017700635.1| PREDICTED: transcription repressor OFP13-like [Phoenix dactylifera] Length = 250 Score = 78.2 bits (191), Expect = 2e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKE 320 EMV AH+LREW L ELLHCYLRLNE+K H +I+LAFVDL M LV++DKE Sbjct: 185 EMVEAHQLREWPRLHELLHCYLRLNEEKTHEIILLAFVDLLMHLVSQDKE 234 >ref|XP_020084001.1| transcription repressor OFP13-like [Ananas comosus] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKE 320 +EMV AH L+EW LEELLHCYL LNEK+ H++I+LAFVDL M +++RDKE Sbjct: 143 KEMVEAHRLKEWPQLEELLHCYLSLNEKETHKIIILAFVDLLMHIMSRDKE 193 >ref|XP_020685693.1| transcription repressor OFP13-like [Dendrobium catenatum] gb|PKU72951.1| hypothetical protein MA16_Dca007514 [Dendrobium catenatum] Length = 236 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/49 (65%), Positives = 42/49 (85%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDK 323 EMV AHELR+W L+ELLHCYL+LN++K+H++IVLAFVDL M L+ +K Sbjct: 169 EMVKAHELRDWPRLQELLHCYLQLNDRKNHKIIVLAFVDLLMHLMTHEK 217 >ref|XP_020585245.1| transcription repressor OFP13-like [Phalaenopsis equestris] Length = 208 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDK 323 EMV HELR+W L++LLHCYLRLN++K H++IVLAFVDL M L+A ++ Sbjct: 142 EMVKVHELRDWPRLQQLLHCYLRLNDRKTHKIIVLAFVDLIMHLMAHEE 190 >ref|XP_020571327.1| nucleolar complex protein 3 homolog isoform X2 [Phalaenopsis equestris] Length = 847 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDK 323 EMV HELR+W L++LLHCYLRLN++K H++IVLAFVDL M L+A ++ Sbjct: 781 EMVKVHELRDWPRLQQLLHCYLRLNDRKTHKIIVLAFVDLIMHLMAHEE 829 >ref|XP_020571325.1| nucleolar complex protein 3 homolog isoform X1 [Phalaenopsis equestris] ref|XP_020571326.1| nucleolar complex protein 3 homolog isoform X1 [Phalaenopsis equestris] Length = 1047 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = -2 Query: 469 EMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDK 323 EMV HELR+W L++LLHCYLRLN++K H++IVLAFVDL M L+A ++ Sbjct: 981 EMVKVHELRDWPRLQQLLHCYLRLNDRKTHKIIVLAFVDLIMHLMAHEE 1029 >ref|XP_009391617.1| PREDICTED: transcription repressor OFP13-like [Musa acuminata subsp. malaccensis] Length = 203 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKE 320 EEMV AHEL+EW L+EL + YLRLNE+K+ +VIVLAFVDL M L+ +D+E Sbjct: 148 EEMVVAHELKEWDSLQELPNWYLRLNERKNRKVIVLAFVDLLMHLMDQDEE 198 >ref|XP_006854716.1| transcription repressor OFP13 [Amborella trichopoda] gb|ERN16183.1| hypothetical protein AMTR_s00030p00235460 [Amborella trichopoda] Length = 219 Score = 65.5 bits (158), Expect = 6e-10 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVA 332 EEMV AH ++EW CLEELL CYLR+N KK H+ IV AFVDL + L++ Sbjct: 169 EEMVQAHGIKEWSCLEELLQCYLRVNGKKAHKYIVGAFVDLLIGLLS 215 >ref|XP_020242992.1| transcription repressor OFP13-like [Asparagus officinalis] gb|ONK59179.1| uncharacterized protein A4U43_C08F3790 [Asparagus officinalis] Length = 174 Score = 64.3 bits (155), Expect = 8e-10 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLV 335 EEMV AH +REW LEELL CYLRLNE+++H IV+AFVD LV Sbjct: 106 EEMVKAHGVREWERLEELLLCYLRLNERRNHEAIVMAFVDFVKNLV 151 >ref|XP_012828687.1| PREDICTED: transcription repressor OFP15-like [Erythranthe guttata] gb|EYU18097.1| hypothetical protein MIMGU_mgv1a025702mg [Erythranthe guttata] Length = 268 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARD 326 EEMVAAH L+EW CLEE+L C+LR+N K +H IV AFVDL + L D Sbjct: 148 EEMVAAHGLKEWDCLEEMLTCFLRVNGKSNHGYIVGAFVDLLLHLALSD 196 >ref|XP_011094255.1| transcription repressor OFP13-like [Sesamum indicum] Length = 271 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQL 338 EEMV AH L+EW CLEELL CYLR+N K +H IV AFVDL ++L Sbjct: 156 EEMVEAHGLKEWECLEELLSCYLRVNGKSNHGYIVGAFVDLLLRL 200 >ref|XP_006849249.1| transcription repressor OFP13 [Amborella trichopoda] gb|ERN10830.1| hypothetical protein AMTR_s00027p00238760 [Amborella trichopoda] Length = 249 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARDKEE 317 EEM+ AH LR+W L ELL CYL+LNEK+ H+ IV AF+DL ++VA + E Sbjct: 196 EEMIEAHGLRDWAMLHELLQCYLKLNEKRTHKYIVGAFLDLLFKMVAEAERE 247 >gb|EPS72109.1| hypothetical protein M569_02648, partial [Genlisea aurea] Length = 108 Score = 60.8 bits (146), Expect = 4e-09 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQL 338 EEMVAAH +R+W LEELL CYLR+N K +H I+ AFVD+++++ Sbjct: 64 EEMVAAHGIRDWDALEELLSCYLRVNAKSNHGYIISAFVDVWIRI 108 >gb|PKA60440.1| hypothetical protein AXF42_Ash008500 [Apostasia shenzhenica] Length = 204 Score = 62.4 bits (150), Expect = 7e-09 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -2 Query: 472 EEMVAAH-ELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQLVARD 326 EEMVAAH +R+W L+ELL CYL LNEKK H +IVLAF DL +Q D Sbjct: 145 EEMVAAHGPVRDWRRLQELLVCYLMLNEKKIHEIIVLAFADLLLQFTEED 194 >ref|XP_022855066.1| transcription repressor OFP15-like [Olea europaea var. sylvestris] Length = 281 Score = 63.2 bits (152), Expect = 8e-09 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -2 Query: 472 EEMVAAHELREWHCLEELLHCYLRLNEKKHHRVIVLAFVDLFMQL 338 EEMV A+ L+ W CLEELL CYLRLN KK+H IV AFVDL + L Sbjct: 153 EEMVEAYGLKNWECLEELLTCYLRLNSKKNHGYIVGAFVDLLVHL 197