BLASTX nr result
ID: Cheilocostus21_contig00040947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040947 (763 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ37611.1| putative reverse transcriptase zinc-binding domai... 57 8e-06 >gb|PRQ37611.1| putative reverse transcriptase zinc-binding domain-containing protein [Rosa chinensis] Length = 308 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +3 Query: 417 VGKLCWLYTMPKIKIFGWKLLQGKLPTLDLLRKMKLWNTAICTLCNREEESATQIF 584 + KL L PKIKIFGW LL+G+L T D L + + N C LCNR+ E+A +F Sbjct: 233 INKLWKLNVQPKIKIFGWLLLRGRLKTRDRLSRFGIINDNSCLLCNRDNETADHLF 288