BLASTX nr result
ID: Cheilocostus21_contig00040928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040928 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60017.1| uncharacterized protein A4U43_C08F13330 [Asparagu... 55 4e-06 >gb|ONK60017.1| uncharacterized protein A4U43_C08F13330 [Asparagus officinalis] Length = 185 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 5 KVSRCFTFLPIIKLLNSRVVEAHFSPTCPKCAP 103 KV RC TF PII+LL+SRVV AHFSP CPK AP Sbjct: 149 KVPRCVTFPPIIELLDSRVVSAHFSPACPKWAP 181