BLASTX nr result
ID: Cheilocostus21_contig00040878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040878 (1542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021901808.1| transcription factor-like protein DPB [Caric... 59 6e-06 gb|PHT43461.1| Transcription factor Dp-1 [Capsicum baccatum] 58 8e-06 ref|XP_012704658.1| transcription factor-like protein DPB isofor... 59 1e-05 >ref|XP_021901808.1| transcription factor-like protein DPB [Carica papaya] Length = 266 Score = 58.9 bits (141), Expect = 6e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 GLQNLVQ*NEQLYGSGQVPSGGVALPFILVQVSLLCFTF 117 GLQNL+Q NEQLY S PSGGVALPFILVQV+ L ++F Sbjct: 224 GLQNLIQRNEQLYSSENAPSGGVALPFILVQVNFLIYSF 262 >gb|PHT43461.1| Transcription factor Dp-1 [Capsicum baccatum] Length = 208 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 GLQNLVQ*NEQLYGSGQVPSGGVALPFILVQVS 99 GLQNL++ NEQLYGSG PSGGVALPFILVQV+ Sbjct: 165 GLQNLIKRNEQLYGSGNAPSGGVALPFILVQVN 197 >ref|XP_012704658.1| transcription factor-like protein DPB isoform X1 [Setaria italica] Length = 387 Score = 59.3 bits (142), Expect = 1e-05 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 GLQNLVQ*NEQLYGSGQVPSGGVALPFILVQVS 99 GLQNL+Q NEQLYGSG PSGGVALPFILVQV+ Sbjct: 252 GLQNLIQRNEQLYGSGNTPSGGVALPFILVQVN 284