BLASTX nr result
ID: Cheilocostus21_contig00040298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040298 (1018 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV71290.1| Peptidase_M50 domain-containing protein [Cephalo... 59 1e-05 >dbj|GAV71290.1| Peptidase_M50 domain-containing protein [Cephalotus follicularis] Length = 543 Score = 58.5 bits (140), Expect = 1e-05 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 1007 VYFLDGESILETFFCYFTFINRRHRRKVLQFCLVGG 900 VYFLDGESILET C+FT +N R RRKVLQ CL GG Sbjct: 492 VYFLDGESILETTLCHFTSLNPRKRRKVLQICLFGG 527