BLASTX nr result
ID: Cheilocostus21_contig00040208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040208 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019253292.1| PREDICTED: actin-related protein 6-like [Nic... 84 1e-17 ref|XP_016181762.1| actin-related protein 6 [Arachis ipaensis] 87 2e-17 gb|PIA42406.1| hypothetical protein AQUCO_02000095v1 [Aquilegia ... 88 5e-17 ref|XP_020967501.1| actin-related protein 6-like [Arachis ipaensis] 82 6e-17 gb|OIT34786.1| actin-related protein 6 [Nicotiana attenuata] 84 7e-17 gb|KHN08098.1| Actin-related protein 6 [Glycine soja] 87 8e-17 gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] 87 1e-16 ref|XP_017701341.1| PREDICTED: actin-related protein 6, partial ... 85 1e-16 ref|XP_010496531.1| PREDICTED: actin-related protein 6-like, par... 86 1e-16 ref|XP_006392567.1| actin-related protein 6 [Eutrema salsugineum... 87 1e-16 gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] 87 1e-16 ref|XP_020879654.1| actin-related protein 6 [Arabidopsis lyrata ... 87 1e-16 gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] 87 1e-16 ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] ... 87 1e-16 gb|AAM53246.1|AF507914_1 actin-related protein 6 [Arabidopsis th... 87 1e-16 ref|XP_023633679.1| actin-related protein 6 [Capsella rubella] >... 87 1e-16 ref|XP_013625034.1| PREDICTED: actin-related protein 6 [Brassica... 87 1e-16 ref|XP_009106806.1| PREDICTED: actin-related protein 6 [Brassica... 87 1e-16 ref|XP_013649425.1| actin-related protein 6 [Brassica napus] >gi... 87 1e-16 ref|XP_013725282.1| actin-related protein 6-like [Brassica napus] 87 1e-16 >ref|XP_019253292.1| PREDICTED: actin-related protein 6-like [Nicotiana attenuata] Length = 117 Score = 84.3 bits (207), Expect = 1e-17 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDF++MC+TK+EYEE+GSARCR RFFH Sbjct: 76 PILGVWRGGSLLASSPDFDAMCVTKAEYEELGSARCRKRFFH 117 >ref|XP_016181762.1| actin-related protein 6 [Arachis ipaensis] Length = 234 Score = 86.7 bits (213), Expect = 2e-17 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFE+MC+TKSEYEE+GSARCR RFFH Sbjct: 193 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 234 >gb|PIA42406.1| hypothetical protein AQUCO_02000095v1 [Aquilegia coerulea] Length = 437 Score = 88.2 bits (217), Expect = 5e-17 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TKSEYEE+GSARCR RFFH Sbjct: 396 PILGVWRGGSLLASSPDFESMCVTKSEYEELGSARCRRRFFH 437 >ref|XP_020967501.1| actin-related protein 6-like [Arachis ipaensis] Length = 117 Score = 82.4 bits (202), Expect = 6e-17 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG WRGGSLLASSPDFE+MC+TKSEYEE+GS RCR RFFH Sbjct: 76 PILGGWRGGSLLASSPDFEAMCVTKSEYEELGSVRCRKRFFH 117 >gb|OIT34786.1| actin-related protein 6 [Nicotiana attenuata] Length = 195 Score = 84.3 bits (207), Expect = 7e-17 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDF++MC+TK+EYEE+GSARCR RFFH Sbjct: 154 PILGVWRGGSLLASSPDFDAMCVTKAEYEELGSARCRKRFFH 195 >gb|KHN08098.1| Actin-related protein 6 [Glycine soja] Length = 326 Score = 86.7 bits (213), Expect = 8e-17 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFE+MC+TKSEYEE+GSARCR RFFH Sbjct: 285 PILGVWRGGSLLASSPDFEAMCVTKSEYEELGSARCRKRFFH 326 >gb|AAF03459.1|AC009992_1 putative actin [Arabidopsis thaliana] Length = 378 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 337 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 378 >ref|XP_017701341.1| PREDICTED: actin-related protein 6, partial [Phoenix dactylifera] Length = 226 Score = 84.7 bits (208), Expect = 1e-16 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC TKSEYEEIG+ RCR RFFH Sbjct: 185 PILGVWRGGSLLASSPDFESMCTTKSEYEEIGTTRCRRRFFH 226 >ref|XP_010496531.1| PREDICTED: actin-related protein 6-like, partial [Camelina sativa] Length = 298 Score = 85.9 bits (211), Expect = 1e-16 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK++YEE+GSARCR RFFH Sbjct: 257 PILGVWRGGSLLASSPDFESMCVTKADYEELGSARCRRRFFH 298 >ref|XP_006392567.1| actin-related protein 6 [Eutrema salsugineum] gb|ESQ29853.1| hypothetical protein EUTSA_v10011531mg [Eutrema salsugineum] Length = 410 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 369 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 410 >gb|ABA18108.1| actin-related protein 6 [Arabidopsis arenosa] Length = 420 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 379 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >ref|XP_020879654.1| actin-related protein 6 [Arabidopsis lyrata subsp. lyrata] gb|EFH53508.1| hypothetical protein ARALYDRAFT_484760 [Arabidopsis lyrata subsp. lyrata] Length = 420 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 379 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 420 >gb|AAK92721.1| putative actin protein [Arabidopsis thaliana] Length = 421 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 380 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421 >ref|NP_566861.1| actin-related protein 6 [Arabidopsis thaliana] sp|Q8LGE3.1|ARP6_ARATH RecName: Full=Actin-related protein 6; AltName: Full=Protein EARLY IN SHORT DAYS 1; AltName: Full=Protein SUPPRESSOR OF FRIGIDA 3 tpg|DAA00030.1| TPA_exp: actin-related protein 6; AtARP6 [Arabidopsis thaliana] gb|AAM60907.1| putative actin [Arabidopsis thaliana] gb|AAN12968.1| putative actin [Arabidopsis thaliana] gb|AEE77716.1| actin-related protein 6 [Arabidopsis thaliana] gb|OAO89390.1| SUF3 [Arabidopsis thaliana] Length = 421 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 380 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 421 >gb|AAM53246.1|AF507914_1 actin-related protein 6 [Arabidopsis thaliana] Length = 422 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 381 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 422 >ref|XP_023633679.1| actin-related protein 6 [Capsella rubella] gb|ABA18103.1| actin-related protein 6 [Capsella rubella] Length = 423 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 382 PILGVWRGGSLLASSPDFESMCVTKTEYEELGSARCRRRFFH 423 >ref|XP_013625034.1| PREDICTED: actin-related protein 6 [Brassica oleracea var. oleracea] Length = 427 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 386 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 427 >ref|XP_009106806.1| PREDICTED: actin-related protein 6 [Brassica rapa] Length = 427 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 386 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 427 >ref|XP_013649425.1| actin-related protein 6 [Brassica napus] emb|CDY42404.1| BnaA08g00100D [Brassica napus] Length = 427 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 386 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 427 >ref|XP_013725282.1| actin-related protein 6-like [Brassica napus] Length = 428 Score = 87.0 bits (214), Expect = 1e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 570 PILGIWRGGSLLASSPDFESMCITKSEYEEIGSARCRHRFFH 445 PILG+WRGGSLLASSPDFESMC+TK+EYEE+GSARCR RFFH Sbjct: 387 PILGVWRGGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH 428