BLASTX nr result
ID: Cheilocostus21_contig00040152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00040152 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009393433.1| PREDICTED: phospholipase ABHD3-like [Musa ac... 57 4e-06 >ref|XP_009393433.1| PREDICTED: phospholipase ABHD3-like [Musa acuminata subsp. malaccensis] Length = 584 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 129 SPELMATASCTDEASAIGLVLRAAAMTPAAHYMLAALLILL 7 SP MA+A+C DE SA GL LRA AM PAAHY+ A+LL+LL Sbjct: 2 SPASMASAACVDEISAAGLFLRAVAMVPAAHYLAASLLVLL 42