BLASTX nr result
ID: Cheilocostus21_contig00039595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00039595 (558 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008793415.1| PREDICTED: RING finger and transmembrane dom... 66 2e-09 ref|XP_009406862.1| PREDICTED: RING finger and transmembrane dom... 66 2e-09 ref|XP_009386897.1| PREDICTED: RING finger and transmembrane dom... 64 1e-08 gb|OVA02210.1| zinc finger protein [Macleaya cordata] 63 3e-08 ref|XP_010278942.1| PREDICTED: RING finger and transmembrane dom... 63 4e-08 ref|XP_010938062.1| PREDICTED: RING finger and transmembrane dom... 63 4e-08 emb|CAN82461.1| hypothetical protein VITISV_005516 [Vitis vinifera] 61 8e-08 ref|XP_010921207.1| PREDICTED: uncharacterized protein LOC105044... 62 1e-07 ref|XP_017697062.1| PREDICTED: uncharacterized protein LOC103702... 61 1e-07 ref|XP_019077287.1| PREDICTED: RING finger and transmembrane dom... 61 2e-07 ref|XP_002265744.1| PREDICTED: RING finger and transmembrane dom... 61 2e-07 gb|ONK67976.1| uncharacterized protein A4U43_C05F5830 [Asparagus... 60 3e-07 gb|KMZ58686.1| RING finger protein [Zostera marina] 59 8e-07 ref|XP_024188214.1| RING finger and transmembrane domain-contain... 59 1e-06 ref|XP_009421416.1| PREDICTED: RING finger and transmembrane dom... 58 1e-06 gb|OAY65019.1| RING finger and transmembrane domain-containing p... 57 4e-06 ref|XP_020271624.1| RING finger and transmembrane domain-contain... 57 5e-06 ref|XP_020103472.1| RING finger and transmembrane domain-contain... 57 5e-06 gb|ONK62722.1| uncharacterized protein A4U43_C07F7420 [Asparagus... 57 5e-06 ref|XP_020701844.1| RING finger and transmembrane domain-contain... 56 6e-06 >ref|XP_008793415.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 [Phoenix dactylifera] Length = 419 Score = 66.2 bits (160), Expect = 2e-09 Identities = 40/76 (52%), Positives = 47/76 (61%), Gaps = 11/76 (14%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV-GDGPRGHPPG----------A 508 Y + FS S FIQA LSA LE G+LR R+SH E+ESL+ G G R H G Sbjct: 27 YGVHFSTSNFIQAPLSALLEYSGILRPRSSHQENESLITGSGLRNHVSGRLDDSAVAGAG 86 Query: 509 EEGEVSIRIVGAGDQE 556 +GEVSIRI+G GDQE Sbjct: 87 GDGEVSIRIIGVGDQE 102 >ref|XP_009406862.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 [Musa acuminata subsp. malaccensis] Length = 480 Score = 66.2 bits (160), Expect = 2e-09 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 9/74 (12%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDGPRGHPPG---------AEE 514 YR+Q S FI++RLS L+ GVLR R SHAE+E LVG R H G Sbjct: 27 YRVQLLASNFIRSRLSDVLDHFGVLRPRASHAEAEGLVGGESRVHASGRIGGSAASTGSG 86 Query: 515 GEVSIRIVGAGDQE 556 GEVSIRI+G GDQE Sbjct: 87 GEVSIRIIGVGDQE 100 >ref|XP_009386897.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 [Musa acuminata subsp. malaccensis] Length = 483 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 12/77 (15%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDGPRGHPP------------G 505 +R++FSPS I+A LS LE G+LR R H+E E +VG+ R H P G Sbjct: 26 FRIRFSPSNLIRAPLSTLLEYSGILRTRAGHSEGEIMVGESMRDHGPGRIGESSLPGVGG 85 Query: 506 AEEGEVSIRIVGAGDQE 556 + GEV+IRI+G GD E Sbjct: 86 SGSGEVAIRIIGVGDHE 102 >gb|OVA02210.1| zinc finger protein [Macleaya cordata] Length = 439 Score = 63.2 bits (152), Expect = 3e-08 Identities = 35/77 (45%), Positives = 46/77 (59%), Gaps = 12/77 (15%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDGPRG------------HPPG 505 + +QFS + FIQA LSA LE G+LR R+SH E+ESL+ P P Sbjct: 25 FGMQFSATNFIQAPLSALLEYSGILRTRSSHQETESLINGNPSSGFRDRIQNRLDDSGPA 84 Query: 506 AEEGEVSIRIVGAGDQE 556 + +GEVSIRI+GA +QE Sbjct: 85 SSDGEVSIRIIGAAEQE 101 >ref|XP_010278942.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 [Nelumbo nucifera] Length = 484 Score = 62.8 bits (151), Expect = 4e-08 Identities = 40/77 (51%), Positives = 47/77 (61%), Gaps = 12/77 (15%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDGP----RGH--------PPG 505 Y +QFS S FIQA LSA LE G+LR R+SH E+ESLV G R H G Sbjct: 24 YGVQFSASNFIQAPLSALLEYSGILRGRSSHLETESLVSGGAATGLRDHIQSRLDDSAAG 83 Query: 506 AEEGEVSIRIVGAGDQE 556 + EVSIRI+GAG+QE Sbjct: 84 SSGDEVSIRIIGAGEQE 100 >ref|XP_010938062.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 [Elaeis guineensis] Length = 490 Score = 62.8 bits (151), Expect = 4e-08 Identities = 39/79 (49%), Positives = 46/79 (58%), Gaps = 14/79 (17%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV----GDGPRGHPPG-------- 505 Y + FS S FIQA LSA LE G+LR R SH E+ESL+ G G R H G Sbjct: 30 YGVHFSTSNFIQAPLSALLEYSGILRPRLSHQENESLISGAAGSGLRDHVSGRLDDSAVA 89 Query: 506 --AEEGEVSIRIVGAGDQE 556 +GEV+IRI+G GDQE Sbjct: 90 GAGGDGEVTIRIIGVGDQE 108 >emb|CAN82461.1| hypothetical protein VITISV_005516 [Vitis vinifera] Length = 253 Score = 60.8 bits (146), Expect = 8e-08 Identities = 38/70 (54%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV-GDGPRGH----PPGAEEGEVS 526 Y +Q S S IQA LSA LE G+LR R+SH E+ESL+ G G R P + GEVS Sbjct: 65 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYGSGFRDRVEESAPVSNGGEVS 124 Query: 527 IRIVGAGDQE 556 IRI+GAG+QE Sbjct: 125 IRIIGAGEQE 134 >ref|XP_010921207.1| PREDICTED: uncharacterized protein LOC105044863 isoform X2 [Elaeis guineensis] Length = 907 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/79 (49%), Positives = 45/79 (56%), Gaps = 14/79 (17%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV----GDGPRGHPPG-------- 505 Y + FS S FIQA LSA LE G+LR R SH E+ESL+ G R H G Sbjct: 27 YGVHFSASNFIQAPLSALLEYSGILRPRPSHQENESLISGAAGSALRDHVSGRLDDSAVA 86 Query: 506 --AEEGEVSIRIVGAGDQE 556 +GEVSIRI+G GDQE Sbjct: 87 GTGGDGEVSIRIIGVGDQE 105 >ref|XP_017697062.1| PREDICTED: uncharacterized protein LOC103702234 [Phoenix dactylifera] Length = 939 Score = 61.2 bits (147), Expect = 1e-07 Identities = 39/79 (49%), Positives = 46/79 (58%), Gaps = 14/79 (17%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESL----VGDGPRGHPPG-------- 505 Y + FS S FIQA LSA LE G+LR R+SH E+ESL +G G R G Sbjct: 29 YGVHFSASNFIQAPLSALLEYSGILRPRSSHHENESLISGAIGSGLRDRVSGRLDDPAVA 88 Query: 506 --AEEGEVSIRIVGAGDQE 556 +GEVSIRI+G GDQE Sbjct: 89 GTGGDGEVSIRIIGVGDQE 107 >ref|XP_019077287.1| PREDICTED: RING finger and transmembrane domain-containing protein 2 isoform X2 [Vitis vinifera] Length = 434 Score = 60.8 bits (146), Expect = 2e-07 Identities = 38/70 (54%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV-GDGPRGH----PPGAEEGEVS 526 Y +Q S S IQA LSA LE G+LR R+SH E+ESL+ G G R P + GEVS Sbjct: 22 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYGSGFRDRVEESAPVSNGGEVS 81 Query: 527 IRIVGAGDQE 556 IRI+GAG+QE Sbjct: 82 IRIIGAGEQE 91 >ref|XP_002265744.1| PREDICTED: RING finger and transmembrane domain-containing protein 1 isoform X1 [Vitis vinifera] Length = 462 Score = 60.8 bits (146), Expect = 2e-07 Identities = 38/70 (54%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV-GDGPRGH----PPGAEEGEVS 526 Y +Q S S IQA LSA LE G+LR R+SH E+ESL+ G G R P + GEVS Sbjct: 22 YGMQLSASNIIQAPLSALLEYSGLLRGRSSHQETESLIYGSGFRDRVEESAPVSNGGEVS 81 Query: 527 IRIVGAGDQE 556 IRI+GAG+QE Sbjct: 82 IRIIGAGEQE 91 >gb|ONK67976.1| uncharacterized protein A4U43_C05F5830 [Asparagus officinalis] Length = 509 Score = 60.1 bits (144), Expect = 3e-07 Identities = 36/66 (54%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRL-RTSHAESESLVGDGPRGHPPGAEEGEVSIRIV 538 Y +QFSP FIQA LS LE G+L+ R+SH ESE L P +GEVSIRI+ Sbjct: 97 YSVQFSPFSFIQAPLSTLLEYSGILQNPRSSHQESEPLA-------PAAPSDGEVSIRII 149 Query: 539 GAGDQE 556 GAGDQE Sbjct: 150 GAGDQE 155 >gb|KMZ58686.1| RING finger protein [Zostera marina] Length = 492 Score = 58.9 bits (141), Expect = 8e-07 Identities = 40/82 (48%), Positives = 47/82 (57%), Gaps = 19/82 (23%) Frame = +2 Query: 368 LQFSPSGFIQARLSAALEDLGVLR---LRTSHAESESLVGDGP------------RGHPP 502 LQFSPS F+QA +SA LE GVLR R +H+ESESL+ G R P Sbjct: 29 LQFSPSSFMQAPISALLEYTGVLRPVTSRLNHSESESLISGGDVGSTVLRDHGSVRTDDP 88 Query: 503 GAE----EGEVSIRIVGAGDQE 556 GA GEVSIRI+G GDQ+ Sbjct: 89 GASGSGGGGEVSIRIIGLGDQD 110 >ref|XP_024188214.1| RING finger and transmembrane domain-containing protein 2 [Rosa chinensis] gb|PRQ42636.1| putative transcription factor C2H2 family [Rosa chinensis] Length = 471 Score = 58.5 bits (140), Expect = 1e-06 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 9/69 (13%) Frame = +2 Query: 377 SPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDGP----RGHPPG-----AEEGEVSI 529 S S FIQA LSA LE G+LR R+SH E+ESL+G R H G + +GEVSI Sbjct: 29 SASNFIQAPLSALLEYSGLLRGRSSHQEAESLIGGRSAAAFREHHHGQVDQSSNDGEVSI 88 Query: 530 RIVGAGDQE 556 RI+GAG+QE Sbjct: 89 RIIGAGEQE 97 >ref|XP_009421416.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Musa acuminata subsp. malaccensis] Length = 482 Score = 58.2 bits (139), Expect = 1e-06 Identities = 38/77 (49%), Positives = 44/77 (57%), Gaps = 12/77 (15%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLVGDG---PRGHPPGAEE------ 514 Y + +S S IQA LSA LE G+LR S +ESE L+G G P P +E Sbjct: 27 YVIPYSASNLIQAPLSALLEYSGILRPEASQSESERLIGGGLPLPEVGPARVDESSTSPT 86 Query: 515 ---GEVSIRIVGAGDQE 556 GEVSIRIVGAGDQE Sbjct: 87 GGGGEVSIRIVGAGDQE 103 >gb|OAY65019.1| RING finger and transmembrane domain-containing protein 2, partial [Ananas comosus] Length = 529 Score = 57.0 bits (136), Expect = 4e-06 Identities = 38/85 (44%), Positives = 43/85 (50%), Gaps = 22/85 (25%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV----------GDGPRGHPPGAE 511 Y +QFS S FIQA LSA LE G+LR R+ H E ESL+ G G R H Sbjct: 84 YGVQFSASNFIQAPLSALLEYSGILRARSGHPEGESLIGGGGVIAAAAGGGTRDHVSSRI 143 Query: 512 E------------GEVSIRIVGAGD 550 E GEVSIRI+G GD Sbjct: 144 EESAAATNSSGGGGEVSIRIIGVGD 168 >ref|XP_020271624.1| RING finger and transmembrane domain-containing protein 2 [Asparagus officinalis] Length = 446 Score = 56.6 bits (135), Expect = 5e-06 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLR-LRTSHAESESLVGDGPRGHPPGAEEGEVSIRIV 538 Y +QFS S FIQA LSA LE G+LR ++SH E+E L P +GEV+IRI+ Sbjct: 24 YGVQFSASNFIQAPLSALLEYSGILRNPQSSHQETEPLTS----APPAAPSDGEVAIRII 79 Query: 539 GAGDQE 556 GAGD E Sbjct: 80 GAGDHE 85 >ref|XP_020103472.1| RING finger and transmembrane domain-containing protein 2-like [Ananas comosus] Length = 488 Score = 56.6 bits (135), Expect = 5e-06 Identities = 38/86 (44%), Positives = 43/86 (50%), Gaps = 23/86 (26%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV-----------GDGPRGHPPGA 508 Y +QFS S FIQA LSA LE G+LR R+ H E ESL+ G G R H Sbjct: 21 YGVQFSASNFIQAPLSALLEYSGILRARSGHPEGESLIGGGGVIAAAAGGGGTRDHVSSR 80 Query: 509 EE------------GEVSIRIVGAGD 550 E GEVSIRI+G GD Sbjct: 81 IEESAAAAHSSGGGGEVSIRIIGVGD 106 >gb|ONK62722.1| uncharacterized protein A4U43_C07F7420 [Asparagus officinalis] Length = 916 Score = 56.6 bits (135), Expect = 5e-06 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLR-LRTSHAESESLVGDGPRGHPPGAEEGEVSIRIV 538 Y +QFS S FIQA LSA LE G+LR ++SH E+E L P +GEV+IRI+ Sbjct: 494 YGVQFSASNFIQAPLSALLEYSGILRNPQSSHQETEPLTS----APPAAPSDGEVAIRII 549 Query: 539 GAGDQE 556 GAGD E Sbjct: 550 GAGDHE 555 >ref|XP_020701844.1| RING finger and transmembrane domain-containing protein 2-like [Dendrobium catenatum] gb|PKU65154.1| RING-H2 finger protein ATL40 [Dendrobium catenatum] Length = 490 Score = 56.2 bits (134), Expect = 6e-06 Identities = 39/78 (50%), Positives = 43/78 (55%), Gaps = 13/78 (16%) Frame = +2 Query: 362 YRLQFSPSGFIQARLSAALEDLGVLRLRTSHAESESLV------GDGPRGHPPGAEE--- 514 Y L FS S IQA LSA LE G+LR R+SH ESE+L+ G G RG E Sbjct: 31 YGLPFSTSNLIQAPLSALLEYSGILRPRSSHLESENLIGRGIIAGTGERGTAQVDESFVT 90 Query: 515 ----GEVSIRIVGAGDQE 556 GEVSIRI GDQE Sbjct: 91 DSSGGEVSIRIFDIGDQE 108