BLASTX nr result
ID: Cheilocostus21_contig00038904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00038904 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009401779.1| PREDICTED: carbon catabolite repressor prote... 106 1e-23 gb|ONM41212.1| Carbon catabolite repressor protein 4 homolog 6 [... 90 1e-20 ref|XP_020242675.1| carbon catabolite repressor protein 4 homolo... 95 2e-19 gb|ONK59481.1| uncharacterized protein A4U43_C08F6870 [Asparagus... 95 2e-19 ref|XP_020671768.1| carbon catabolite repressor protein 4 homolo... 94 2e-19 ref|XP_008796428.1| PREDICTED: carbon catabolite repressor prote... 92 1e-18 ref|XP_002458143.1| carbon catabolite repressor protein 4 homolo... 92 1e-18 ref|XP_019707039.1| PREDICTED: carbon catabolite repressor prote... 92 1e-18 ref|XP_010917938.1| PREDICTED: carbon catabolite repressor prote... 92 1e-18 ref|XP_008796427.1| PREDICTED: carbon catabolite repressor prote... 92 1e-18 gb|OEL27696.1| Carbon catabolite repressor protein 4-like protei... 91 3e-18 ref|XP_010254301.1| PREDICTED: carbon catabolite repressor prote... 91 3e-18 ref|XP_010254300.1| PREDICTED: carbon catabolite repressor prote... 91 3e-18 ref|XP_010254298.1| PREDICTED: carbon catabolite repressor prote... 91 3e-18 ref|XP_010254296.1| PREDICTED: carbon catabolite repressor prote... 91 3e-18 ref|XP_012701459.2| carbon catabolite repressor protein 4 homolo... 91 5e-18 gb|PKA49048.1| Carbon catabolite repressor protein 4 like 6 [Apo... 91 5e-18 ref|XP_020105909.1| carbon catabolite repressor protein 4 homolo... 91 5e-18 ref|XP_020580807.1| carbon catabolite repressor protein 4 homolo... 90 6e-18 gb|ERN16396.1| hypothetical protein AMTR_s00052p00118920, partia... 90 7e-18 >ref|XP_009401779.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 [Musa acuminata subsp. malaccensis] ref|XP_009401787.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 [Musa acuminata subsp. malaccensis] Length = 877 Score = 106 bits (264), Expect = 1e-23 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANGSFTE 173 GTVDYIW SEGLQTA+VLETFPK VLQQT GFPT+RWGSDH+ALACELAF NGS T+ Sbjct: 821 GTVDYIWSSEGLQTARVLETFPKHVLQQTSGFPTRRWGSDHVALACELAFTNGSSTK 877 >gb|ONM41212.1| Carbon catabolite repressor protein 4 homolog 6 [Zea mays] Length = 75 Score = 89.7 bits (221), Expect = 1e-20 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGL T KVL+TFP ++L++T GFPTK+WGSDHIALACELAF Sbjct: 24 GTVDYIWASEGLHTVKVLDTFPIEILKKTTGFPTKKWGSDHIALACELAF 73 >ref|XP_020242675.1| carbon catabolite repressor protein 4 homolog 6, partial [Asparagus officinalis] Length = 755 Score = 94.7 bits (234), Expect = 2e-19 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANG 161 GTVDYIW SEGLQT KVL+T PK +L++T GFPT+RWGSDH+ALACELAF NG Sbjct: 698 GTVDYIWCSEGLQTVKVLDTIPKHILRRTSGFPTRRWGSDHLALACELAFTNG 750 >gb|ONK59481.1| uncharacterized protein A4U43_C08F6870 [Asparagus officinalis] Length = 799 Score = 94.7 bits (234), Expect = 2e-19 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANG 161 GTVDYIW SEGLQT KVL+T PK +L++T GFPT+RWGSDH+ALACELAF NG Sbjct: 742 GTVDYIWCSEGLQTVKVLDTIPKHILRRTSGFPTRRWGSDHLALACELAFTNG 794 >ref|XP_020671768.1| carbon catabolite repressor protein 4 homolog 6-like [Dendrobium catenatum] Length = 526 Score = 94.4 bits (233), Expect = 2e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANGS 164 GTVDYIW SE LQT KVL+T P+ VLQ+TPGFPT++WGSDHIALACELAF+ GS Sbjct: 470 GTVDYIWCSEELQTVKVLDTIPRHVLQRTPGFPTQKWGSDHIALACELAFSKGS 523 >ref|XP_008796428.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like isoform X2 [Phoenix dactylifera] Length = 840 Score = 92.0 bits (227), Expect = 1e-18 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT KVL+T PK VLQQTPGFPTK+WGSDHIAL C+LAF Sbjct: 784 GTVDYIWCSEDLQTVKVLDTIPKHVLQQTPGFPTKKWGSDHIALVCQLAF 833 >ref|XP_002458143.1| carbon catabolite repressor protein 4 homolog 6 [Sorghum bicolor] gb|EES03263.1| hypothetical protein SORBI_3003G217200 [Sorghum bicolor] Length = 872 Score = 92.0 bits (227), Expect = 1e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGL T +VL+TFPK++L+QT GFPTK+WGSDHIALACELAF Sbjct: 821 GTVDYIWASEGLHTVQVLDTFPKEILKQTIGFPTKKWGSDHIALACELAF 870 >ref|XP_019707039.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform X2 [Elaeis guineensis] Length = 947 Score = 92.0 bits (227), Expect = 1e-18 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT KVL+T P+ VLQQTPGFPTK+WGSDHIALAC+LAF Sbjct: 891 GTVDYIWCSEDLQTVKVLDTIPQHVLQQTPGFPTKKWGSDHIALACQLAF 940 >ref|XP_010917938.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform X1 [Elaeis guineensis] Length = 962 Score = 92.0 bits (227), Expect = 1e-18 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT KVL+T P+ VLQQTPGFPTK+WGSDHIALAC+LAF Sbjct: 906 GTVDYIWCSEDLQTVKVLDTIPQHVLQQTPGFPTKKWGSDHIALACQLAF 955 >ref|XP_008796427.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like isoform X1 [Phoenix dactylifera] Length = 963 Score = 92.0 bits (227), Expect = 1e-18 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT KVL+T PK VLQQTPGFPTK+WGSDHIAL C+LAF Sbjct: 907 GTVDYIWCSEDLQTVKVLDTIPKHVLQQTPGFPTKKWGSDHIALVCQLAF 956 >gb|OEL27696.1| Carbon catabolite repressor protein 4-like protein 6 [Dichanthelium oligosanthes] Length = 911 Score = 91.3 bits (225), Expect = 3e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT +VL+TFPK++L+QT GFPTK+WGSDHIALACELAF Sbjct: 860 GTVDYIWASEDLQTVQVLDTFPKEILKQTIGFPTKKWGSDHIALACELAF 909 >ref|XP_010254301.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform X5 [Nelumbo nucifera] Length = 649 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGLQT KVL+T PK ++Q TPGFPT +WGSDHIALAC+LAF Sbjct: 593 GTVDYIWHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF 642 >ref|XP_010254300.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform X4 [Nelumbo nucifera] Length = 729 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGLQT KVL+T PK ++Q TPGFPT +WGSDHIALAC+LAF Sbjct: 673 GTVDYIWHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF 722 >ref|XP_010254298.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform X3 [Nelumbo nucifera] Length = 813 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGLQT KVL+T PK ++Q TPGFPT +WGSDHIALAC+LAF Sbjct: 757 GTVDYIWHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF 806 >ref|XP_010254296.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform X1 [Nelumbo nucifera] Length = 844 Score = 90.9 bits (224), Expect = 3e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SEGLQT KVL+T PK ++Q TPGFPT +WGSDHIALAC+LAF Sbjct: 788 GTVDYIWHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF 837 >ref|XP_012701459.2| carbon catabolite repressor protein 4 homolog 6 [Setaria italica] gb|KQL05827.1| hypothetical protein SETIT_000272mg [Setaria italica] Length = 865 Score = 90.5 bits (223), Expect = 5e-18 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAF 152 GTVDYIW SE LQT +VL+TFPKQ+L+QT GFPTK+WGSDHIA+ACEL+F Sbjct: 814 GTVDYIWASEDLQTVQVLDTFPKQILKQTIGFPTKKWGSDHIAIACELSF 863 >gb|PKA49048.1| Carbon catabolite repressor protein 4 like 6 [Apostasia shenzhenica] Length = 889 Score = 90.5 bits (223), Expect = 5e-18 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANGSFTE 173 GTVDYIW +E LQT KVL+T PK VL++TPGFPT++WGSDHIALACELAF+ T+ Sbjct: 833 GTVDYIWCTEALQTVKVLDTIPKHVLRRTPGFPTQKWGSDHIALACELAFSKACKTK 889 >ref|XP_020105909.1| carbon catabolite repressor protein 4 homolog 6 [Ananas comosus] Length = 894 Score = 90.5 bits (223), Expect = 5e-18 Identities = 40/57 (70%), Positives = 46/57 (80%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANGSFTE 173 GTVDYIW +E LQT KVL+T P +LQQT GFPTK+WGSDHIAL C+LAF NG T+ Sbjct: 838 GTVDYIWCTEDLQTVKVLDTIPTHILQQTSGFPTKKWGSDHIALVCQLAFTNGVSTK 894 >ref|XP_020580807.1| carbon catabolite repressor protein 4 homolog 6 isoform X2 [Phalaenopsis equestris] ref|XP_020580808.1| carbon catabolite repressor protein 4 homolog 6 isoform X2 [Phalaenopsis equestris] Length = 810 Score = 90.1 bits (222), Expect = 6e-18 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANGSFTE 173 GTVDYIW SE LQT KVL+T PK +LQ+T GFPT++WGSDHIALACELAF+ S T+ Sbjct: 754 GTVDYIWCSEDLQTVKVLDTIPKHILQRTSGFPTQKWGSDHIALACELAFSKVSQTK 810 >gb|ERN16396.1| hypothetical protein AMTR_s00052p00118920, partial [Amborella trichopoda] Length = 887 Score = 90.1 bits (222), Expect = 7e-18 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +3 Query: 3 GTVDYIWRSEGLQTAKVLETFPKQVLQQTPGFPTKRWGSDHIALACELAFANG 161 GTVDYIW SEGLQT KVL T PK VLQ+T GFPT++WGSDH+ALAC+LAF +G Sbjct: 828 GTVDYIWCSEGLQTVKVLGTLPKHVLQRTRGFPTQKWGSDHLALACQLAFTDG 880