BLASTX nr result
ID: Cheilocostus21_contig00038167
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00038167 (1531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ97321.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 3e-06 gb|ONM15587.1| Soluble inorganic pyrophosphatase [Zea mays] 59 4e-06 >dbj|BAJ97321.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 173 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 96 YVIM*VVEITKGSKVKYELDKKTGLIKVDRIL 1 Y+++ VVEITKGSKVKYELDKKTGLIKVDR+L Sbjct: 8 YILLQVVEITKGSKVKYELDKKTGLIKVDRVL 39 >gb|ONM15587.1| Soluble inorganic pyrophosphatase [Zea mays] Length = 253 Score = 59.3 bits (142), Expect = 4e-06 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 6/44 (13%) Frame = -2 Query: 114 CLNPC------FYVIM*VVEITKGSKVKYELDKKTGLIKVDRIL 1 CL P Y+ M VVEITKGSKVKYELDKKTGLIKVDR+L Sbjct: 76 CLEPSTGSDCIIYIFMQVVEITKGSKVKYELDKKTGLIKVDRVL 119