BLASTX nr result
ID: Cheilocostus21_contig00038004
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00038004 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011655038.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethylt... 57 3e-06 ref|XP_018677196.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethylt... 57 4e-06 ref|XP_022146818.1| tRNA (guanine(26)-N(2))-dimethyltransferase ... 57 4e-06 ref|XP_022986521.1| tRNA (guanine(26)-N(2))-dimethyltransferase ... 56 5e-06 ref|XP_022943113.1| tRNA (guanine(26)-N(2))-dimethyltransferase ... 56 5e-06 ref|XP_021684884.1| tRNA (guanine(26)-N(2))-dimethyltransferase-... 56 6e-06 ref|XP_021684886.1| tRNA (guanine(26)-N(2))-dimethyltransferase-... 56 6e-06 ref|XP_008456934.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethylt... 56 6e-06 >ref|XP_011655038.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase [Cucumis sativus] ref|XP_011655039.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase [Cucumis sativus] gb|KGN50729.1| hypothetical protein Csa_5G220920 [Cucumis sativus] Length = 440 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 521 GYAASRSHIAANAIKTNCPIAECIQLALVLRNRVSVDAVS 402 GYAASRSHIA+NAIKTNCP+AECI++A + RN + V+ Sbjct: 401 GYAASRSHIASNAIKTNCPMAECIRIAQLQRNCLGAHQVT 440 >ref|XP_018677196.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase [Musa acuminata subsp. malaccensis] Length = 437 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -2 Query: 524 EGYAASRSHIAANAIKTNCPIAECIQLALVLR 429 EGY ASRSHIA NAIKTNCPIAECIQ A LR Sbjct: 391 EGYVASRSHIAPNAIKTNCPIAECIQFARRLR 422 >ref|XP_022146818.1| tRNA (guanine(26)-N(2))-dimethyltransferase [Momordica charantia] Length = 439 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 521 GYAASRSHIAANAIKTNCPIAECIQLALVLRN 426 GYAASRSHIA+NAIKTNCP+AECI++AL L++ Sbjct: 402 GYAASRSHIASNAIKTNCPMAECIRIALELQH 433 >ref|XP_022986521.1| tRNA (guanine(26)-N(2))-dimethyltransferase [Cucurbita maxima] Length = 441 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 521 GYAASRSHIAANAIKTNCPIAECIQLALVLR 429 GYAASRSHIA+NAIKTNCP+AECI++AL L+ Sbjct: 401 GYAASRSHIASNAIKTNCPMAECIRIALELQ 431 >ref|XP_022943113.1| tRNA (guanine(26)-N(2))-dimethyltransferase [Cucurbita moschata] Length = 441 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 521 GYAASRSHIAANAIKTNCPIAECIQLALVLR 429 GYAASRSHIA+NAIKTNCP+AECI++AL L+ Sbjct: 401 GYAASRSHIASNAIKTNCPMAECIRIALELQ 431 >ref|XP_021684884.1| tRNA (guanine(26)-N(2))-dimethyltransferase-like isoform X1 [Hevea brasiliensis] Length = 429 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 524 EGYAASRSHIAANAIKTNCPIAECIQLALVLR 429 EGYA SRSHIA+NAIKTNCP+AECI++A LR Sbjct: 393 EGYAVSRSHIASNAIKTNCPMAECIRIAKELR 424 >ref|XP_021684886.1| tRNA (guanine(26)-N(2))-dimethyltransferase-like isoform X2 [Hevea brasiliensis] Length = 429 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 524 EGYAASRSHIAANAIKTNCPIAECIQLALVLR 429 EGYA SRSHIA+NAIKTNCP+AECI++A LR Sbjct: 393 EGYAVSRSHIASNAIKTNCPMAECIRIAKELR 424 >ref|XP_008456934.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase isoform X1 [Cucumis melo] ref|XP_008456936.1| PREDICTED: tRNA (guanine(26)-N(2))-dimethyltransferase isoform X1 [Cucumis melo] Length = 440 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -2 Query: 521 GYAASRSHIAANAIKTNCPIAECIQLALVLRNRVSVDAVS 402 GYAASRSHIA+NAIKTNCP+A+CI++A + +N + V V+ Sbjct: 401 GYAASRSHIASNAIKTNCPMADCIRIAQLQQNCLGVHQVT 440