BLASTX nr result
ID: Cheilocostus21_contig00037861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00037861 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018685554.1| PREDICTED: uncharacterized protein LOC108953... 81 1e-14 >ref|XP_018685554.1| PREDICTED: uncharacterized protein LOC108953550 [Musa acuminata subsp. malaccensis] Length = 396 Score = 81.3 bits (199), Expect = 1e-14 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 210 KIPLPRSPSLPNHFVRAVGDKLVEYKEPVYEWERADDAWKFWDFIPSGCEL 58 ++ LPR PS N FVRAVGD LVEYKEPV++WE+A+DAWK WDF+P GC + Sbjct: 54 RVSLPRIPS-SNRFVRAVGDPLVEYKEPVFQWEKANDAWKLWDFVPLGCNI 103