BLASTX nr result
ID: Cheilocostus21_contig00037316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00037316 (725 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019708256.1| PREDICTED: probable leucine-rich repeat rece... 59 3e-06 ref|XP_017700169.1| PREDICTED: probable leucine-rich repeat rece... 58 5e-06 >ref|XP_019708256.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Elaeis guineensis] Length = 968 Score = 58.9 bits (141), Expect = 3e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 581 ALYSMAGNWQKSPSCWLRSDPCTSNWVGINCSNSHVI 691 AL S+A +W+ PS W+ SDPC NWVGI+C+NSHVI Sbjct: 46 ALISLASSWENPPSNWIGSDPCGDNWVGISCNNSHVI 82 >ref|XP_017700169.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Phoenix dactylifera] Length = 985 Score = 58.2 bits (139), Expect = 5e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = +2 Query: 581 ALYSMAGNWQKSPSCWLRSDPCTSNWVGINCSNSHVI 691 AL+++A +W P W+ SDPC SNWVGI CSNSH+I Sbjct: 67 ALHALAESWDNPPQSWVGSDPCGSNWVGITCSNSHII 103