BLASTX nr result
ID: Cheilocostus21_contig00036901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036901 (705 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009420995.1| PREDICTED: probable protein phosphatase 2C 3... 60 1e-06 >ref|XP_009420995.1| PREDICTED: probable protein phosphatase 2C 39 [Musa acuminata subsp. malaccensis] ref|XP_009420996.1| PREDICTED: probable protein phosphatase 2C 39 [Musa acuminata subsp. malaccensis] Length = 530 Score = 59.7 bits (143), Expect = 1e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +2 Query: 557 MGAEISIEEKARSNQLDVRGSPILYSENMQEFESISKTPNDLNVSFGYQ 703 MGAEIS+EE+AR N R P L SE M+EF+ K+ +DLNVSFGYQ Sbjct: 1 MGAEISLEERARHNHQCTRSLPFLCSEKMEEFDKSPKSSSDLNVSFGYQ 49