BLASTX nr result
ID: Cheilocostus21_contig00036707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036707 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388857.1| PREDICTED: sugar carrier protein C-like [Mus... 64 6e-09 ref|XP_010904882.1| PREDICTED: sugar carrier protein C [Elaeis g... 55 7e-06 ref|XP_008812644.1| PREDICTED: sugar carrier protein C-like [Pho... 55 7e-06 >ref|XP_009388857.1| PREDICTED: sugar carrier protein C-like [Musa acuminata subsp. malaccensis] Length = 522 Score = 63.9 bits (154), Expect = 6e-09 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 2 WRKHWFWGKFIADEDVHVGKAEIEVGNGKHKSYA 103 WR HWFW KFIADEDVHVGKAE E+ NGK KS A Sbjct: 488 WRSHWFWSKFIADEDVHVGKAETEMSNGKPKSDA 521 >ref|XP_010904882.1| PREDICTED: sugar carrier protein C [Elaeis guineensis] Length = 520 Score = 55.1 bits (131), Expect = 7e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 WRKHWFWGKFIADEDVHVGKAEIEVGNGKHKS 97 W+ HWFWGKFIADED+HVG IE+G+GK K+ Sbjct: 488 WKAHWFWGKFIADEDIHVG--NIEMGHGKSKA 517 >ref|XP_008812644.1| PREDICTED: sugar carrier protein C-like [Phoenix dactylifera] Length = 520 Score = 55.1 bits (131), Expect = 7e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +2 Query: 2 WRKHWFWGKFIADEDVHVGKAEIEVGNGKHKS 97 W+ HWFWG FIADED+HVG +E+GNGK K+ Sbjct: 488 WKSHWFWGNFIADEDIHVG--NVEMGNGKSKA 517