BLASTX nr result
ID: Cheilocostus21_contig00036568
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036568 (660 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020570696.1| beta-glucuronosyltransferase GlcAT14A-like [... 57 6e-06 >ref|XP_020570696.1| beta-glucuronosyltransferase GlcAT14A-like [Phalaenopsis equestris] Length = 402 Score = 57.0 bits (136), Expect = 6e-06 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +3 Query: 3 WWTDPCSEWGNANIVRLTSRSDKFGKLMKNLLYDWXXXXXXCR 131 WW+DPCS+W N N+VR ++++KFG MK LL +W CR Sbjct: 359 WWSDPCSQWKNVNLVRPGAQAEKFGDFMKRLLEEWSSGSNSCR 401