BLASTX nr result
ID: Cheilocostus21_contig00036431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036431 (921 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399547.1| PREDICTED: nuclear pore complex protein NUP9... 77 1e-11 >ref|XP_009399547.1| PREDICTED: nuclear pore complex protein NUP96 [Musa acuminata subsp. malaccensis] Length = 1066 Score = 76.6 bits (187), Expect = 1e-11 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 4/70 (5%) Frame = -1 Query: 198 NSHLIHNRQNET---DCHSMILTQSNGRRIPYT-DEESLLPSLNSSDYYTKPSIDELEAR 31 +SH + N Q+E DC S+ L Q RRI + D ESLLPSL+SSDY+TKPSIDEL A Sbjct: 23 DSHFVCNCQSEAILDDCTSVNLAQCKRRRISCSRDVESLLPSLSSSDYFTKPSIDELAAH 82 Query: 30 EIVDPGYCSR 1 EIVD GYCSR Sbjct: 83 EIVDSGYCSR 92