BLASTX nr result
ID: Cheilocostus21_contig00036114
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036114 (901 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276319.1| uncharacterized protein LOC109850674 [Aspara... 61 6e-08 >ref|XP_020276319.1| uncharacterized protein LOC109850674 [Asparagus officinalis] gb|ONK62994.1| uncharacterized protein A4U43_C07F10290 [Asparagus officinalis] Length = 141 Score = 61.2 bits (147), Expect = 6e-08 Identities = 43/103 (41%), Positives = 54/103 (52%), Gaps = 6/103 (5%) Frame = -3 Query: 512 VKQLLLAPIRRPEAIEGQRTRRKKQSEYEKQQSRPPDPPPLGYSYSFDASSKGC----CL 345 VK L++ P+ + E + TR+K+ RPP P P YS F KGC C Sbjct: 52 VKNLVMRPLIKFEKV---CTRKKR---------RPP-PAPFPYSEDF---GKGCHPHLCF 95 Query: 344 --PIGAHHPPGDPRPAKKFSNYHLFLRSIIEKNDFFSKECNVH 222 P PP P P +K S+YH FLR+ IE NDF+S ECNVH Sbjct: 96 VQPRVDDSPPLRPNPDRKTSSYHDFLRNFIESNDFYSPECNVH 138